Ghoul's Writer (UK) (1994) [UTILITAIRE].dsk
HexaDumpAscii only
000000:  45 58 54 45 4E 44 45 44 20 43 50 43 20 44 53 4B    EXTENDED CPC DSK
000010:  20 46 69 6C 65 0D 0A 44 69 73 6B 2D 49 6E 66 6F     File..Disk-Info
000020:  0D 0A 53 41 4D 64 69 73 6B 31 38 30 37 30 37 00    ..SAMdisk180707.
000030:  2A 01 00 00 13 13 13 13 13 13 13 13 13 13 13 13    *...............
000040:  13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13    ................
000050:  13 13 13 13 13 13 13 13 13 13 13 13 13 13 00 00    ................
000060:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
000070:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
000080:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
000090:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0000A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0000B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0000C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0000D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0000E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0000F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
000100:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
000110:  00 00 01 00 02 09 4F E5 00 00 C1 02 00 00 00 02    ......O.........
000120:  00 00 C6 02 00 00 00 02 00 00 C2 02 00 00 00 02    ................
000130:  00 00 C7 02 00 00 00 02 00 00 C3 02 00 00 00 02    ................
000140:  00 00 C8 02 00 00 00 02 00 00 C4 02 00 00 00 02    ................
000150:  00 00 C9 02 00 00 00 02 00 00 C5 02 00 00 00 02    ................
000160:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
000170:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
000180:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
000190:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0001A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0001B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0001C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0001D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0001E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0001F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
000200:  00 2D 47 57 2D 46 52 20 20 42 41 53 00 00 00 06    .-GW-FR  BAS....
000210:  02 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
000220:  00 2D 47 57 45 44 49 54 20 42 41 53 00 00 00 03    .-GWEDIT BAS....
000230:  03 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
000240:  00 2D 47 57 4C 4F 47 4F 20 42 41 53 00 00 00 0A    .-GWLOGO BAS....
000250:  04 05 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
000260:  00 42 55 42 42 4C 45 20 20 47 57 58 00 00 00 07    .BUBBLE  GWX....
000270:  06 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
000280:  00 43 50 43 20 20 20 20 20 47 57 45 00 00 00 03    .CPC     GWE....
000290:  07 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0002A0:  00 46 49 56 45 20 20 20 20 46 4E 54 00 00 00 07    .FIVE    FNT....
0002B0:  08 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0002C0:  00 47 57 2D 55 4B 20 20 20 44 4F 43 00 00 00 7D    .GW-UK   DOC...}
0002D0:  09 0A 0B 0C 0D 0E 0F 10 11 12 13 14 15 16 17 18    ................
0002E0:  00 49 4E 54 52 4F 20 20 20 44 41 54 00 00 00 0D    .INTRO   DAT....
0002F0:  19 1A 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
000300:  00 4C 49 4E 45 20 20 20 20 47 57 45 00 00 00 03    .LINE    GWE....
000310:  1B 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
000320:  00 4D 4F 55 54 48 20 20 20 47 57 45 00 00 00 03    .MOUTH   GWE....
000330:  1C 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
000340:  00 50 43 20 20 20 20 20 20 47 57 45 00 00 00 03    .PC      GWE....
000350:  1D 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
000360:  00 52 41 4E 44 4F 4D 20 20 47 57 45 00 00 00 03    .RANDOM  GWE....
000370:  1E 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
000380:  00 53 4E 4F 57 20 20 20 20 47 57 58 00 00 00 04    .SNOW    GWX....
000390:  1F 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0003A0:  00 53 55 42 4D 41 52 49 4E 47 57 58 00 00 00 0F    .SUBMARINGWX....
0003B0:  20 21 00 00 00 00 00 00 00 00 00 00 00 00 00 00     !..............
0003C0:  00 55 50 2D 44 4F 57 4E 32 47 57 45 00 00 00 03    .UP-DOWN2GWE....
0003D0:  22 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    "...............
0003E0:  00 2D 47 57 2D 53 54 20 20 42 41 53 00 00 00 26    .-GW-ST  BAS...&
0003F0:  23 24 25 26 27 00 00 00 00 00 00 00 00 00 00 00    #$%&'...........
000400:  00 00 63 61 6E 61 EC 20 EF 20 0E 20 EB 20 0D 00    ..cana. . . . ..
000410:  00 E1 EF 0D 00 00 E1 F4 0F 01 A1 20 0D 00 00 E1    ........... ....
000420:  EF 19 19 20 EB 20 0D 00 00 E1 EF 0F 01 CC 20 0F    ... . ........ .
000430:  2C 19 28 2C 16 2C 19 0F 01 83 20 1C 18 BB 01 AD    ,.(,.,.... .....
000440:  20 10 20 00 69 00 78 00 D5 01 88 01 83 20 1C 18     . .i.x...... ..
000450:  BB 01 AD 20 10 01 A9 20 19 12 2C 19 0C 01 BF 20    ... ... ..,.... 
000460:  22 3C 52 3E 20 2E 2E 2E 2E 2E 2E 2E 2E 2E 2E 2E    "<R> ...........
000470:  2E 2E 2E 20 3E 20 52 65 73 74 61 72 74 20 70 72    ... > Restart pr
000480:  6F 67 72 61 6D 22 01 A9 20 19 12 2C 19 0F 01 BF    ogram".. ..,....
000490:  20 22 3C 51 3E 20 2E 2E 2E 2E 2E 2E 2E 2E 2E 2E     "<Q> ..........
0004A0:  2E 2E 2E 2E 20 3E 20 51 75 69 74 22 00 46 00 82    .... > Quit".F..
0004B0:  00 03 00 00 EB EF 22 22 01 D6 20 03 00 00 EB F2    ......"".. .....
0004C0:  22 72 22 20 FA 20 03 00 00 EB F2 22 71 22 01 03    "r" . ....."q"..
0004D0:  00 00 EB EF FF 11 28 FF 43 29 01 D5 01 A1 20 03    ......(.C).... .
0004E0:  00 00 EB EF 22 71 22 20 EB 20 83 20 0E 01 01 97    ...."q" . . ....
0004F0:  20 CA 00 00 00 1A 77 61 72 65 20 21 0D 0A 0D 0A     .....ware !....
000500:  A2 20 0F 2C 19 12 01 AD 20 10 00 75 00 3C 00 BF    . .,.... ..u.<..
000510:  20 22 50 72 69 6E 74 20 75 73 65 72 27 73 20 6D     "Print user's m
000520:  61 6E 75 61 6C 20 28 59 20 2F 20 4E 29 22 01 03    anual (Y / N)"..
000530:  00 00 EB EF 22 22 01 D6 20 03 00 00 EB F2 22 59    ...."".. ....."Y
000540:  22 20 FA 20 03 00 00 EB F2 22 4E 22 01 03 00 00    " . ....."N"....
000550:  EB EF FF 1C 28 FF 43 29 01 D5 01 0D 00 00 63 61    ....(.C)......ca
000560:  6E 61 EC EF 0E 01 A1 20 03 00 00 EB EF 22 59 22    na..... ....."Y"
000570:  20 EB 20 0D 00 00 63 61 6E 61 EC 20 EF 20 16 00     . ...cana. . ..
000580:  24 00 46 00 A1 20 0D 00 00 63 61 6E 61 EC EF 16    $.F.. ...cana...
000590:  20 EB 20 BF 20 22 50 72 69 6E 74 69 6E 67 2E 2E     . . "Printing..
0005A0:  2E 2E 22 00 16 00 50 00 AD 20 10 01 B6 20 22 47    .."...P.. ... "G
0005B0:  57 2D 46 52 2E 44 4F 43 22 00 1E 00 5A 00 0D 00    W-FR.DOC"...Z...
0005C0:  00 E1 EF 0F 01 D6 20 FE 20 FF 40 01 A6 20 A3 20    ...... . .@.. £ 
0005D0:  23 17 2C 03 00 00 E2 00 21 00 64 00 A1 20 FF 40    #.,.....!.d.. .@
0005E0:  20 EF 20 0E 20 EB 20 BF 20 23 0D 00 00 63 61 6E     . . . . #...can
0005F0:  61 EC 2C 20 03 00 00 E2 00 4B 00 6E 00 A1 20 0D    a., .....K.n.. .
000600:  00 2D 47 57 46 4F 4E 54 20 42 41 53 00 00 00 09    .-GWFONT BAS....
000610:  28 29 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ()..............
000620:  00 41 43 43 45 4E 54 53 20 44 41 54 00 00 00 02    .ACCENTS DAT....
000630:  2A 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    *...............
000640:  00 43 48 41 4D 50 41 47 32 47 57 58 00 00 00 04    .CHAMPAG2GWX....
000650:  2B 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    +...............
000660:  00 43 55 52 54 41 49 4E 20 47 57 45 00 00 00 03    .CURTAIN GWE....
000670:  2C 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ,...............
000680:  00 47 2D 57 20 20 20 20 20 47 57 4C 00 00 00 1D    .G-W     GWL....
000690:  2D 2E 2F 30 00 00 00 00 00 00 00 00 00 00 00 00    -./0............
0006A0:  00 47 57 44 45 4D 4F 20 20 42 49 4E 00 00 00 46    .GWDEMO  BIN...F
0006B0:  31 32 33 34 35 36 37 38 39 00 00 00 00 00 00 00    123456789.......
0006C0:  00 4C 41 52 47 45 52 20 20 46 4E 54 00 00 00 07    .LARGER  FNT....
0006D0:  3A 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    :...............
0006E0:  00 4C 49 4E 45 4F 55 54 20 46 4E 54 00 00 00 07    .LINEOUT FNT....
0006F0:  3B 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ;...............
000700:  00 4E 4F 2D 46 58 32 20 20 47 57 58 00 00 00 02    .NO-FX2  GWX....
000710:  3C 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    <...............
000720:  00 50 43 2D 43 47 41 20 20 47 57 45 00 00 00 03    .PC-CGA  GWE....
000730:  3D 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    =...............
000740:  00 53 43 52 49 50 54 32 20 46 4E 54 00 00 00 07    .SCRIPT2 FNT....
000750:  3E 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    >...............
000760:  00 53 51 55 41 52 45 20 20 46 4E 54 00 00 00 07    .SQUARE  FNT....
000770:  3F 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ?...............
000780:  00 53 59 53 2D 46 52 20 20 46 4E 54 00 00 00 07    .SYS-FR  FNT....
000790:  40 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    @...............
0007A0:  00 57 41 4C 45 53 20 20 20 4D 55 53 00 00 00 1B    .WALES   MUS....
0007B0:  41 42 43 44 00 00 00 00 00 00 00 00 00 00 00 00    ABCD............
0007C0:  00 2D 47 57 2D 55 4B 20 20 42 41 53 00 00 00 06    .-GW-UK  BAS....
0007D0:  45 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    E...............
0007E0:  00 2D 47 57 46 52 41 4D 45 42 41 53 00 00 00 05    .-GWFRAMEBAS....
0007F0:  46 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    F...............
000800:  00 2D 47 57 45 44 49 54 20 42 41 53 00 00 00 00    .-GWEDIT BAS....
000810:  00 00 00 00 00 70 01 00 C8 00 00 00 00 00 00 00    .....p..........
000820:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
000830:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
000840:  C8 00 00 E8 04 69 74 2E 62 69 6E 22 2C 1C 00 80    .....it.bin",...
000850:  00 17 00 1E 00 A8 20 22 73 79 73 2D 75 6B 2E 66    ...... "sys-uk.f
000860:  6E 74 22 2C 1C 00 98 00 19 00 28 00 A8 20 22 6D    nt",......(.. "m
000870:  6F 72 65 2D 63 68 72 2E 64 61 74 22 2C 1C 08 9B    ore-chr.dat",...
000880:  23 00 01 00 01 C0 20 47 68 6F 75 6C 27 73 20 77    #..... Ghoul's w
000890:  72 69 74 65 72 20 65 64 69 74 6F 72 20 76 20 31    riter editor v 1
0008A0:  2E 30 00 07 00 02 00 01 C0 00 24 00 03 00 01 C0    .0........$.....
0008B0:  20 54 6F 6D 20 65 74 20 4A 65 72 72 79 20 6F 66     Tom et Jerry of
0008C0:  20 47 50 41 20 28 63 29 20 31 39 39 34 00 07 00     GPA (c) 1994...
0008D0:  04 00 01 C0 00 20 00 0A 00 83 20 1C 4E BB 01 86    ..... .... .N...
0008E0:  01 AA 20 1F 00 00 09 25 90 01 B7 22 64 22 01 AA    .. ....%..."d"..
0008F0:  20 1C FF 7F 00 17 00 14 00 A8 20 22 67 77 65 64     ......... "gwed
000900:  69 74 2E 62 69 6E 22 2C 1C 00 80 00 17 00 1E 00    it.bin",........
000910:  A8 20 22 73 79 73 2D 75 6B 2E 66 6E 74 22 2C 1C    . "sys-uk.fnt",.
000920:  00 98 00 19 00 28 00 A8 20 22 6D 6F 72 65 2D 63    .....(.. "more-c
000930:  68 72 2E 64 61 74 22 2C 1C 08 9B 00 0A 00 32 00    hr.dat",......2.
000940:  83 20 1C 00 88 00 00 00 1A 45 44 49 54 20 20 24    . .......EDIT  $
000950:  24 24 FF 00 FF 72 6F 72 2E 2E 2E 20 20 46 69 6C    $$...ror...  Fil
000960:  65 20 68 61 73 20 6E 6F 20 6E 61 6D 65 2E 2E 2E    e has no name...
000970:  00 1A 26 39 35 30 30 0D 0A 57 52 49 54 45 20 22    ..&9500..WRITE "
000980:  00 41 43 43 45 4E 54 53 20 44 41 54 00 00 00 02    .ACCENTS DAT....
000990:  A2 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0009A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0009B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0009C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0009D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0009E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0009F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
000A00:  00 41 52 4D 59 20 20 20 20 46 4E 54 00 00 00 07    .ARMY    FNT....
000A10:  47 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    G...............
000A20:  00 43 48 41 4D 50 41 47 4E 47 57 58 00 00 00 03    .CHAMPAGNGWX....
000A30:  48 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    H...............
000A40:  00 44 45 50 45 43 48 45 20 4D 55 53 00 00 00 24    .DEPECHE MUS...$
000A50:  49 4A 4B 4C 4D 00 00 00 00 00 00 00 00 00 00 00    IJKLM...........
000A60:  00 47 57 2D 43 4C 49 50 20 53 43 52 00 00 00 80    .GW-CLIP SCR....
000A70:  4E 4F 50 51 52 53 54 55 56 57 58 59 5A 5B 5C 5D    NOPQRSTUVWXYZ[\]
000A80:  00 47 57 2D 43 4C 49 50 20 53 43 52 01 00 00 01    .GW-CLIP SCR....
000A90:  5E 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ^...............
000AA0:  00 47 57 45 44 49 54 20 20 42 49 4E 00 00 00 31    .GWEDIT  BIN...1
000AB0:  5F 60 61 62 63 64 65 00 00 00 00 00 00 00 00 00    _`abcde.........
000AC0:  00 4C 45 47 45 4E 44 20 20 4D 55 53 00 00 00 21    .LEGEND  MUS...!
000AD0:  66 67 68 69 6A 00 00 00 00 00 00 00 00 00 00 00    fghij...........
000AE0:  00 4D 49 52 41 47 45 20 20 47 57 45 00 00 00 03    .MIRAGE  GWE....
000AF0:  6B 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    k...............
000B00:  00 4E 4F 2D 4C 4F 47 4F 20 47 57 4C 00 00 00 1D    .NO-LOGO GWL....
000B10:  6C 6D 6E 6F 00 00 00 00 00 00 00 00 00 00 00 00    lmno............
000B20:  00 50 49 47 20 20 20 20 20 47 57 4C 00 00 00 1D    .PIG     GWL....
000B30:  70 71 72 73 00 00 00 00 00 00 00 00 00 00 00 00    pqrs............
000B40:  00 53 49 4C 56 45 52 4D 41 4D 55 53 00 00 00 2B    .SILVERMAMUS...+
000B50:  74 75 76 77 78 79 00 00 00 00 00 00 00 00 00 00    tuvwxy..........
000B60:  00 53 51 55 41 52 45 2D 31 46 4E 54 00 00 00 07    .SQUARE-1FNT....
000B70:  7A 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    z...............
000B80:  00 53 59 53 2D 55 4B 20 20 46 4E 54 00 00 00 07    .SYS-UK  FNT....
000B90:  7B 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    {...............
000BA0:  00 59 45 53 4F 44 20 20 20 4D 55 53 00 00 00 3B    .YESOD   MUS...;
000BB0:  7C 7D 7E 7F 80 81 82 83 00 00 00 00 00 00 00 00    |}~.............
000BC0:  00 2D 47 57 44 45 4D 4F 20 42 41 53 00 00 00 02    .-GWDEMO BAS....
000BD0:  84 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
000BE0:  00 2D 47 57 4C 49 4E 4B 20 42 41 53 00 00 00 04    .-GWLINK BAS....
000BF0:  85 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
000C00:  65 20 61 6C 72 65 61 64 79 20 6C 6F 61 64 65 64    e already loaded
000C10:  20 69 6E 20 6D 65 6D 6F 72 79 20 28 59 2F 4E 29     in memory (Y/N)
000C20:  22 00 30 00 78 00 03 00 00 EB EF 22 22 01 D6 20    ".0.x......"".. 
000C30:  03 00 00 EB F2 22 59 22 20 FA 20 03 00 00 EB F2    ....."Y" . .....
000C40:  22 4E 22 01 03 00 00 EB EF FF 1C 28 FF 43 29 01    "N"........(.C).
000C50:  D5 00 17 00 82 00 A1 20 03 00 00 EB EF 22 59 22    ....... ....."Y"
000C60:  20 EB 20 A0 20 1E F0 00 00 0A 00 8C 00 AA 20 1C     . . ......... .
000C70:  FF 8F 00 07 00 96 00 01 C0 00 2D 00 A0 00 01 C0    ..........-.....
000C80:  20 4C 6F 61 64 20 2E 53 43 52 20 66 69 6C 65 20     Load .SCR file 
000C90:  28 66 6F 6E 74 20 73 74 61 72 74 73 20 61 74 20    (font starts at 
000CA0:  26 43 30 30 30 29 00 08 00 AA 00 01 C0 20 00 34    &C000)....... .4
000CB0:  00 B4 00 BF 01 A3 20 22 4E 61 6D 65 20 6F 66 20    .....£ "Name of 
000CC0:  74 68 65 20 31 37 6B 6F 20 66 6F 6E 74 20 66 69    the 17ko font fi
000CD0:  6C 65 20 3A 20 22 2C 03 00 00 6C 6F 61 64 66 69    le : ",...loadfi
000CE0:  6C E5 00 2A 00 BE 00 0D 00 00 73 63 72 65 65 EE    l..*......scree.
000CF0:  EF 1C 00 C0 01 A8 20 03 00 00 6C 6F 61 64 66 69    ...... ...loadfi
000D00:  6C E5 2C 0D 00 00 73 63 72 65 65 EE 00 0A 00 C8    l.,...scree.....
000D10:  00 A0 20 1E 22 01 00 07 00 D2 00 01 C0 00 1C 00    .. ."...........
000D20:  DC 00 01 C0 20 50 72 69 6E 74 20 66 6F 6E 74 20    .... Print font 
000D30:  69 6E 20 6D 65 6D 6F 72 79 00 07 00 E6 00 01 C0    in memory.......
000D40:  00 23 00 F0 00 8A 01 9E 20 0D 00 00 E9 EF 19 20    .#...... ...... 
000D50:  20 EC 20 19 80 01 BF 20 FF 03 28 0D 00 00 E9 29     . .... ..(....)
000D60:  3B 01 B0 00 12 00 FA 00 0D 00 00 73 63 72 65 65    ;..........scree
000D70:  EE EF 1C F0 C0 00 08 00 04 01 01 C0 20 00 14 00    ............ ...
000D80:  0E 01 01 C0 20 6D 61 69 6E 20 77 6F 72 6B 2E 2E    .... main work..
000D90:  2E 00 07 00 18 01 01 C0 00 20 00 22 01 9E 20 0D    ......... .".. .
000DA0:  00 00 EA EF 0E 20 EC 20 28 0D 00 00 6E 62 63 68    ..... . (...nbch
000DB0:  61 72 F3 20 F5 20 0F 29 00 1C 00 2C 01 9E 20 0D    ar. . .)...,.. .
000DC0:  00 00 E9 EF 0E 20 EC 20 0D 00 00 6E 62 6C 69 6E    ..... . ...nblin
000DD0:  65 F3 F5 0F 00 22 00 36 01 0D 00 00 74 72 61 73    e....".6....tras
000DE0:  E8 EF 0D 00 00 73 63 72 65 65 EE F4 28 0D 00 00    .....scree..(...
000DF0:  E9 F6 1C 00 08 29 00 43 00 40 01 BE 20 0D 00 00    .....).C.@.. ...
000E00:  00 42 4F 49 4E 47 20 20 20 47 57 58 00 00 00 09    .BOING   GWX....
000E10:  86 87 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
000E20:  00 43 4C 41 53 53 49 43 20 46 4E 54 00 00 00 07    .CLASSIC FNT....
000E30:  88 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
000E40:  00 46 41 43 45 20 20 20 20 4D 55 53 00 00 00 2F    .FACE    MUS.../
000E50:  89 8A 8B 8C 8D 8E 00 00 00 00 00 00 00 00 00 00    ................
000E60:  00 47 57 2D 46 52 20 20 20 44 4F 43 00 00 00 80    .GW-FR   DOC....
000E70:  8F 90 91 92 93 94 95 96 97 98 99 9A 9B 9C 9D 9E    ................
000E80:  00 47 57 2D 46 52 20 20 20 44 4F 43 01 00 00 1C    .GW-FR   DOC....
000E90:  9F A0 A1 A2 00 00 00 00 00 00 00 00 00 00 00 00    ................
000EA0:  00 47 57 4C 49 4E 4B 20 20 42 49 4E 00 00 00 22    .GWLINK  BIN..."
000EB0:  A3 A4 A5 A6 A7 00 00 00 00 00 00 00 00 00 00 00    £...............
000EC0:  00 4C 49 47 48 54 20 20 20 46 4E 54 00 00 00 07    .LIGHT   FNT....
000ED0:  A8 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
000EE0:  00 4D 4F 52 45 2D 43 48 52 44 41 54 00 00 00 02    .MORE-CHRDAT....
000EF0:  A9 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
000F00:  00 4E 4F 2D 4D 55 53 49 43 4D 55 53 00 00 00 02    .NO-MUSICMUS....
000F10:  AA 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
000F20:  00 52 41 49 4E 20 20 20 20 47 57 58 00 00 00 04    .RAIN    GWX....
000F30:  AB 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
000F40:  00 53 49 4E 55 53 20 20 20 47 57 58 00 00 00 07    .SINUS   GWX....
000F50:  AC 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
000F60:  00 53 54 41 52 46 49 45 4C 47 57 58 00 00 00 03    .STARFIELGWX....
000F70:  AD 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
000F80:  00 55 50 2D 44 4F 57 4E 20 47 57 45 00 00 00 03    .UP-DOWN GWE....
000F90:  AE 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
000FA0:  00 59 4F 50 20 20 20 20 20 4D 55 53 00 00 00 22    .YOP     MUS..."
000FB0:  AF B0 B1 B2 B3 00 00 00 00 00 00 00 00 00 00 00    ................
000FC0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
000FD0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
000FE0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
000FF0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
001000:  00 2D 47 57 4C 4F 47 4F 20 42 41 53 00 00 00 00    .-GWLOGO BAS....
001010:  00 00 00 00 00 70 01 00 6F 04 00 00 00 00 00 00    .....p..o.......
001020:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001030:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001040:  6F 04 00 49 04 31 2C 31 30 2C 46 31 2C 30 31 2C    o..I.1,10,F1,01,
001050:  35 30 2C 43 30 2C 30 39 00 12 00 5E 01 8C 20 33    50,C0,09...^.. 3
001060:  44 2C 32 30 2C 45 38 2C 43 39 00 3A 00 68 01 C7    D,20,E8,C9.:.h..
001070:  20 1E 4A 01 01 9E 20 0D 00 00 E9 EF 1C 00 A0 20     .J... ........ 
001080:  24 00 01 00 01 C0 20 47 68 6F 75 6C 27 73 20 77    $..... Ghoul's w
001090:  72 69 74 65 72 20 4C 6F 67 6F 20 63 72 65 61 74    riter Logo creat
0010A0:  6F 72 20 00 07 00 02 00 01 C0 00 24 00 03 00 01    or ........$....
0010B0:  C0 20 54 6F 6D 20 65 74 20 4A 65 72 72 79 20 6F    . Tom et Jerry o
0010C0:  66 20 47 50 41 20 28 63 29 20 31 39 39 34 00 07    f GPA (c) 1994..
0010D0:  00 04 00 01 C0 00 1F 00 0A 00 83 20 1C 4E BB 01    ........... .N..
0010E0:  82 20 0E 01 A2 20 0E 2C 0E 01 A2 20 0F 2C 19 1A    . ... .,... .,..
0010F0:  01 AD 20 10 00 11 00 14 00 B7 22 64 22 01 AA 20    .. ......."d".. 
001100:  1C FF 3F 01 89 00 42 00 1E 00 BF 20 22 47 68 6F    ..?...B.... "Gho
001110:  75 6C 27 73 20 77 72 69 74 65 72 20 6C 6F 67 6F    ul's writer logo
001120:  20 63 72 65 61 74 6F 72 20 20 54 6F 6D 20 65 74     creator  Tom et
001130:  20 4A 65 72 72 79 20 6F 66 20 47 50 41 20 28 63     Jerry of GPA (c
001140:  29 20 31 39 39 34 22 00 16 00 28 00 A9 20 0F 2C    ) 1994"...(.. .,
001150:  10 01 BF 20 FF 7B 28 19 50 2C 19 9A 29 00 10 00    ... .{(.P,..)...
001160:  32 00 D8 20 0F 2C 19 50 2C 12 2C 19 19 00 08 00    2.. .,.P,.,.....
001170:  3C 00 01 C0 20 00 16 00 46 00 01 C0 20 4C 6F 61    <... ...F... Loa
001180:  64 20 2E 53 43 52 20 66 69 6C 65 00 07 00 50 00    d .SCR file...P.
001190:  01 C0 00 3A 00 5A 00 BF 20 22 49 6E 73 65 72 74    ...:.Z.. "Insert
0011A0:  20 73 63 72 65 65 6E 20 66 69 6C 65 6E 61 6D 65     screen filename
0011B0:  20 74 6F 20 63 6F 6E 76 65 72 74 20 28 6E 61 6D     to convert (nam
0011C0:  65 20 20 20 20 2E 65 78 74 29 20 22 00 2D 00 64    e    .ext) ".-.d
0011D0:  00 A9 20 19 34 2C 0F 01 BF 20 FF 7B 28 19 14 2C    .. .4,... .{(..,
0011E0:  19 20 29 01 A9 20 19 32 2C 0F 01 A3 20 22 3A 20    . ).. .2,..£ ": 
0011F0:  22 2C 03 00 00 66 69 6C E5 00 27 00 6E 00 A1 20    ",...fil..'.n.. 
001200:  00 2D 47 57 2D 46 52 20 20 42 41 53 00 00 00 00    .-GW-FR  BAS....
001210:  00 00 00 00 00 70 01 00 75 02 00 00 00 00 00 00    .....p..u.......
001220:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001230:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001240:  75 02 00 05 04 6F 67 72 61 6D 22 01 A9 20 19 12    u....ogram".. ..
001250:  2C 19 0F 01 BF 20 22 3C 51 3E 20 2E 2E 2E 2E 2E    ,.... "<Q> .....
001260:  2E 2E 2E 2E 2E 2E 2E 2E 2E 20 3E 20 51 75 69 74    ......... > Quit
001270:  22 00 46 00 82 00 03 00 00 EB EF 22 22 01 D6 20    ".F........"".. 
001280:  39 00 0A 00 01 C0 20 4D 75 6C 74 69 20 4D 61 72    9..... Multi Mar
001290:  6B 20 31 2E 30 20 75 73 65 72 27 73 20 6D 61 6E    k 1.0 user's man
0012A0:  75 65 6C 20 72 65 61 64 65 72 20 28 63 29 20 54    uel reader (c) T
0012B0:  26 4A 20 31 39 39 34 20 00 07 00 14 00 01 C0 00    &J 1994 ........
0012C0:  25 00 1E 00 01 C0 20 53 68 69 74 74 79 20 70 72    %..... Shitty pr
0012D0:  6F 67 72 61 6D 2C 20 6E 6F 20 61 73 6D 20 63 6F    ogram, no asm co
0012E0:  64 65 20 21 00 07 00 28 00 01 C0 00 1F 00 32 00    de !...(......2.
0012F0:  83 20 1C 4E BB 01 82 20 0E 01 A2 20 0E 2C 0E 01    . .N... ... .,..
001300:  A2 20 0F 2C 19 12 01 AD 20 10 00 75 00 3C 00 BF    . .,.... ..u.<..
001310:  20 22 50 72 69 6E 74 20 75 73 65 72 27 73 20 6D     "Print user's m
001320:  61 6E 75 61 6C 20 28 59 20 2F 20 4E 29 22 01 03    anual (Y / N)"..
001330:  00 00 EB EF 22 22 01 D6 20 03 00 00 EB F2 22 59    ...."".. ....."Y
001340:  22 20 FA 20 03 00 00 EB F2 22 4E 22 01 03 00 00    " . ....."N"....
001350:  EB EF FF 1C 28 FF 43 29 01 D5 01 0D 00 00 63 61    ....(.C)......ca
001360:  6E 61 EC EF 0E 01 A1 20 03 00 00 EB EF 22 59 22    na..... ....."Y"
001370:  20 EB 20 0D 00 00 63 61 6E 61 EC 20 EF 20 16 00     . ...cana. . ..
001380:  24 00 46 00 A1 20 0D 00 00 63 61 6E 61 EC EF 16    $.F.. ...cana...
001390:  20 EB 20 BF 20 22 50 72 69 6E 74 69 6E 67 2E 2E     . . "Printing..
0013A0:  2E 2E 22 00 16 00 50 00 AD 20 10 01 B6 20 22 47    .."...P.. ... "G
0013B0:  57 2D 46 52 2E 44 4F 43 22 00 1E 00 5A 00 0D 00    W-FR.DOC"...Z...
0013C0:  00 E1 EF 0F 01 D6 20 FE 20 FF 40 01 A6 20 A3 20    ...... . .@.. £ 
0013D0:  23 17 2C 03 00 00 E2 00 21 00 64 00 A1 20 FF 40    #.,.....!.d.. .@
0013E0:  20 EF 20 0E 20 EB 20 BF 20 23 0D 00 00 63 61 6E     . . . . #...can
0013F0:  61 EC 2C 20 03 00 00 E2 00 4B 00 6E 00 A1 20 0D    a., .....K.n.. .
001400:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
001410:  01 00 01 00 02 09 4E E5 01 00 C1 02 00 00 00 02    ......N.........
001420:  01 00 C6 02 00 00 00 02 01 00 C2 02 00 00 00 02    ................
001430:  01 00 C7 02 00 00 00 02 01 00 C3 02 00 00 00 02    ................
001440:  01 00 C8 02 00 00 00 02 01 00 C4 02 00 00 00 02    ................
001450:  01 00 C9 02 00 00 00 02 01 00 C5 02 00 00 00 02    ................
001460:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001470:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001480:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001490:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0014A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0014B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0014C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0014D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0014E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0014F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001500:  03 00 00 66 69 6C E5 EF 22 22 20 EB 20 A9 20 0F    ...fil.."" . . .
001510:  2C 10 01 84 01 A9 20 0F 2C 0F 01 A0 20 1E 5A 00    ,..... .,... .Z.
001520:  00 1E 00 78 00 D8 20 0F 2C 19 50 2C 13 2C 19 19    ...x.. .,.P,.,..
001530:  01 8A 01 D8 20 0F 2C 19 50 2C 12 2C 19 19 00 1D    .... .,.P,.,....
001540:  00 82 00 A1 20 FF 0E 28 03 00 00 66 69 6C E5 29    .... ..(...fil.)
001550:  EE 19 0C 20 EB 20 A0 20 1E 64 00 00 1C 00 8C 00    ... . . .d......
001560:  BF 01 BF 01 BF 20 22 4C 6F 61 64 69 6E 67 20 66    ..... "Loading f
001570:  69 6C 65 2E 2E 2E 22 00 12 00 96 00 A8 20 03 00    ile..."...... ..
001580:  00 66 69 6C E5 2C 1C 00 40 00 07 00 A0 00 01 C0    .fil.,..@.......
001590:  00 1C 00 AA 00 01 C0 20 50 75 74 20 6C 6F 67 6F    ....... Put logo
0015A0:  20 69 6E 74 6F 20 6D 65 6D 6F 72 79 00 07 00 B4     into memory....
0015B0:  00 01 C0 00 10 00 BE 00 9F 20 1E 4A 01 01 83 20    ......... .J... 
0015C0:  1C 00 A0 00 21 00 C8 00 BF 01 BF 20 22 4C 6F 67    ....!...... "Log
0015D0:  6F 20 6C 6F 61 64 65 64 20 69 6E 20 6D 65 6D 6F    o loaded in memo
0015E0:  72 79 2E 22 00 08 00 D2 00 01 C0 20 00 13 00 DC    ry."....... ....
0015F0:  00 01 C0 20 53 61 76 65 20 6C 6F 67 6F 20 21 00    ... Save logo !.
001600:  07 00 E6 00 01 C0 00 36 00 F0 00 BF 01 BF 20 22    .......6...... "
001610:  49 6E 73 65 72 74 20 6C 6F 67 6F 20 66 69 6C 65    Insert logo file
001620:  6E 61 6D 65 20 28 6E 6F 20 65 78 74 65 6E 73 69    name (no extensi
001630:  6F 6E 20 70 6C 65 61 73 65 29 20 22 00 2D 00 FA    on please) ".-..
001640:  00 A9 20 19 34 2C 15 01 BF 20 FF 7B 28 19 14 2C    .. .4,... .{(..,
001650:  19 20 29 01 A9 20 19 32 2C 15 01 A3 20 22 3A 20    . ).. .2,..£ ": 
001660:  22 2C 03 00 00 6C 6F 67 EF 00 2C 00 04 01 A1 20    ",...log..,.... 
001670:  FF 0E 28 03 00 00 6C 6F 67 EF 29 EF 0E 20 FC 20    ..(...log.).. . 
001680:  FF 0E 28 03 00 00 6C 6F 67 EF 29 EE 16 20 EB 20    ..(...log.).. . 
001690:  A0 20 1E 64 00 00 1F 00 0E 01 03 00 00 6C 6F 67    . .d.........log
0016A0:  EF 20 EF 20 03 00 00 6C 6F 67 EF 20 F4 20 22 2E    . . ...log. . ".
0016B0:  47 57 4C 22 00 48 00 18 01 BF 01 BF 20 22 50 72    GWL".H...... "Pr
0016C0:  65 73 73 20 61 20 6B 65 79 20 74 6F 20 73 61 76    ess a key to sav
0016D0:  65 20 22 3B FF 1C 28 03 00 00 6C 6F 67 EF 29 01    e ";..(...log.).
0016E0:  83 20 1C 18 BB 01 CB 20 03 00 00 6C 6F 67 EF 2C    . ..... ...log.,
0016F0:  0D 00 00 E2 2C 1C 00 80 2C 1C E0 0D 00 08 00 22    ....,...,......"
001700:  00 43 50 43 20 20 20 20 20 47 57 45 00 00 00 00    .CPC     GWE....
001710:  00 00 02 00 00 00 70 00 91 00 00 00 00 00 00 00    ......p.........
001720:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001730:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001740:  91 00 00 ED 03 17 1F 27 2F 37 3F 47 4F 57 5F 67    .......'/7?GOW_g
001750:  6F 77 7F 87 8F FF 1A 70 63 2E 67 77 65 22 2C 0D    ow.....pc.gwe",.
001760:  00 00 E2 2C 1C 00 70 2C 1C 91 00 00 00 00 1A 05    ...,..p,........
001770:  00 24 00 03 07 00 B3 00 3F 00 C0 00 10 00 00 00    .$......?.......
001780:  00 08 10 18 20 28 30 38 40 48 50 58 60 68 70 78    .... (08@HPX`hpx
001790:  80 88 01 09 11 19 21 29 31 39 41 49 51 59 61 69    ......!)19AIQYai
0017A0:  71 79 81 89 02 0A 12 1A 22 2A 32 3A 42 4A 52 5A    qy......"*2:BJRZ
0017B0:  62 6A 72 7A 82 8A 03 0B 13 1B 23 2B 33 3B 43 4B    bjrz......#+3;CK
0017C0:  53 5B 63 6B 73 7B 83 8B 04 0C 14 1C 24 2C 34 3C    S[cks{......$,4<
0017D0:  44 4C 54 5C 64 6C 74 7C 84 8C 05 0D 15 1D 25 2D    DLT\dlt|......%-
0017E0:  35 3D 45 4D 55 5D 65 6D 75 7D 85 8D 06 0E 16 1E    5=EMU]emu}......
0017F0:  26 2E 36 3E 46 4E 56 5E 66 6E 76 7E 86 8E 07 0F    &.6>FNV^fnv~....
001800:  17 1F 27 2F 37 3F 47 4F 57 5F 67 6F 77 7F 87 8F    ..'/7?GOW_gow...
001810:  FF 1A 70 63 2E 67 77 65 22 2C 0D 00 00 E2 2C 1C    ..pc.gwe",....,.
001820:  00 70 2C 1C 91 00 00 00 00 1A 05 00 24 00 03 07    .p,.........$...
001830:  00 B3 00 3F 00 C0 00 10 00 00 00 C1 09 2A 52 E5    ...?.........*R.
001840:  02 04 00 FF 00 42 39 7F 7F 80 80 80 80 80 80 80    .....B9.........
001850:  80 80 80 80 80 FF FF FC 60 01 FC 00 00 00 00 00    ........`.......
001860:  00 00 00 00 00 00 00 00 00 00 00 00 24 00 03 07    ............$...
001870:  00 AA 00 3F 00 C0 00 10 00 02 00 41 09 2A 52 E5    ...?.......A.*R.
001880:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
001890:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0018A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0018B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0018C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0018D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0018E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0018F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
001900:  01 BF 01 98 00 07 00 2C 01 01 C0 00 15 00 36 01    .......,......6.
001910:  01 C0 20 4D 61 69 6E 20 72 6F 75 74 69 6E 65 20    .. Main routine 
001920:  00 07 00 40 01 01 C0 00 36 00 4A 01 8C 20 43 33    ...@....6.J.. C3
001930:  2C 30 33 2C 41 30 2C 33 45 2C 30 36 2C 32 31 2C    ,03,A0,3E,06,21,
001940:  30 30 2C 34 30 2C 31 31 2C 30 30 2C 38 30 2C 30    00,40,11,00,80,0
001950:  36 2C 30 38 2C 43 35 2C 30 31 2C 34 41 00 36 00    6,08,C5,01,4A.6.
001960:  54 01 8C 20 30 30 2C 45 35 2C 45 44 2C 42 30 2C    T.. 00,E5,ED,B0,
001970:  45 31 2C 30 31 2C 30 30 2C 30 38 2C 30 39 2C 43    E1,01,00,08,09,C
001980:  31 2C 31 30 2C 46 31 2C 30 31 2C 35 30 2C 43 30    1,10,F1,01,50,C0
001990:  2C 30 39 00 12 00 5E 01 8C 20 33 44 2C 32 30 2C    ,09...^.. 3D,20,
0019A0:  45 38 2C 43 39 00 3A 00 68 01 C7 20 1E 4A 01 01    E8,C9.:.h.. .J..
0019B0:  9E 20 0D 00 00 E9 EF 1C 00 A0 20 EC 20 1C 23 A0    . ........ . .#.
0019C0:  01 C3 20 03 00 00 E1 01 BE 20 0D 00 00 E9 2C FF    .. ...... ....,.
0019D0:  1D 28 22 26 22 F4 03 00 00 E1 29 01 B0 01 C9 00    .("&".....).....
0019E0:  0D 00 72 01 BF 20 22 61 72 67 68 22 00 00 00 1A    ..r.. "argh"....
0019F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001A00:  07 00 E6 00 01 C0 00 36 00 F0 00 BF 01 BF 20 22    .......6...... "
001A10:  49 6E 73 65 72 74 20 6C 6F 67 6F 20 66 69 6C 65    Insert logo file
001A20:  6E 61 6D 65 20 28 6E 6F 20 65 78 74 65 6E 73 69    name (no extensi
001A30:  6F 6E 20 70 6C 65 61 73 65 29 20 22 00 2D 00 FA    on please) ".-..
001A40:  00 A9 20 19 34 2C 15 01 BF 20 FF 7B 28 19 14 2C    .. .4,... .{(..,
001A50:  19 20 29 01 A9 20 19 32 2C 15 01 A3 20 22 3A 20    . ).. .2,..£ ": 
001A60:  22 2C 03 00 00 6C 6F 67 EF 00 2C 00 04 01 A1 20    ",...log..,.... 
001A70:  FF 0E 28 03 00 00 6C 6F 67 EF 29 EF 0E 20 FC 20    ..(...log.).. . 
001A80:  FF 0E 28 03 00 00 6C 6F 67 EF 29 EE 16 20 EB 20    ..(...log.).. . 
001A90:  A0 20 1E 64 00 00 1F 00 0E 01 03 00 00 6C 6F 67    . .d.........log
001AA0:  EF 20 EF 20 03 00 00 6C 6F 67 EF 20 F4 20 22 2E    . . ...log. . ".
001AB0:  47 57 4C 22 00 48 00 18 01 BF 01 BF 20 22 50 72    GWL".H...... "Pr
001AC0:  65 73 73 20 61 20 6B 65 79 20 74 6F 20 73 61 76    ess a key to sav
001AD0:  65 20 22 3B FF 1C 28 03 00 00 6C 6F 67 EF 29 01    e ";..(...log.).
001AE0:  83 20 1C 18 BB 01 CB 20 03 00 00 6C 6F 67 EF 2C    . ..... ...log.,
001AF0:  0D 00 00 E2 2C 1C 00 80 2C 1C E0 0D 00 08 00 22    ....,...,......"
001B00:  07 01 F3 00 07 01 20 00 07 01 01 0A 01 08 01 00    ...... .........
001B10:  01 00 0A 01 00 1A 01 0B 01 00 1A 01 0C 01 00 1A    ................
001B20:  01 0D 01 00 1A 01 0E 01 00 1A 01 0F 01 00 1A 01    ................
001B30:  10 01 00 1A 01 11 01 00 1A 01 13 01 00 1A 01 14    ................
001B40:  01 00 1A 01 15 01 00 1A 01 07 28 00 01 01 08 28    ..........(....(
001B50:  00 1A 01 09 28 00 1A 01 0A 28 00 1A 01 0B 28 00    ....(....(....(.
001B60:  1A 01 0C 28 00 1A 01 0D 28 00 1A 01 0E 28 00 1A    ...(....(....(..
001B70:  01 0F 28 00 1A 01 10 28 00 1A 01 11 28 00 1A 01    ..(....(....(...
001B80:  12 28 00 1A 01 13 28 00 1A 01 14 28 00 1A 01 15    .(....(....(....
001B90:  28 00 1A 01 16 28 00 1A 01 17 28 00 1A 01 05 01    (....(....(.....
001BA0:  1A 1A 1A 1A 1A 1A 1A 1A 11 14 00 01 00 01 02 03    ................
001BB0:  04 05 06 07 07 09 0A 0B 0C 0D 0E 0F 05 01 1A 1A    ................
001BC0:  1A 1A 1A 1A 1A 1A 11 14 00 01 00 01 02 03 04 05    ................
001BD0:  06 07 07 09 0A 0B 0C 0D 0E 0F 07 03 43 75 72 73    ............Curs
001BE0:  6F 72 20 73 70 65 65 64 00 08 03 43 75 72 73 6F    or speed...Curso
001BF0:  72 20 76 69 73 69 62 6C 65 00 0A 03 54 65 78 74    r visible...Text
001C00:  6C 69 6E 65 20 31 20 63 6F 6C 6F 72 00 0B 03 54    line 1 color...T
001C10:  65 78 74 6C 69 6E 65 20 32 20 63 6F 6C 6F 72 00    extline 2 color.
001C20:  0C 03 54 65 78 74 6C 69 6E 65 20 33 20 63 6F 6C    ..Textline 3 col
001C30:  6F 72 00 0D 03 54 65 78 74 6C 69 6E 65 20 34 20    or...Textline 4 
001C40:  63 6F 6C 6F 72 00 0E 03 54 65 78 74 6C 69 6E 65    color...Textline
001C50:  20 35 20 63 6F 6C 6F 72 00 0F 03 54 65 78 74 6C     5 color...Textl
001C60:  69 6E 65 20 36 20 63 6F 6C 6F 72 00 10 03 54 65    ine 6 color...Te
001C70:  78 74 6C 69 6E 65 20 37 20 63 6F 6C 6F 72 00 11    xtline 7 color..
001C80:  03 54 65 78 74 6C 69 6E 65 20 38 20 63 6F 6C 6F    .Textline 8 colo
001C90:  72 00 13 03 43 6F 6C 6F 72 20 46 78 00 14 03 52    r...Color Fx...R
001CA0:  6F 64 73 20 63 6F 6C 6F 72 00 15 03 50 61 70 65    ods color...Pape
001CB0:  72 20 74 65 78 74 20 63 6F 6C 6F 72 00 07 2A 4C    r text color..*L
001CC0:  6F 67 6F 20 6D 6F 64 65 00 08 2A 4C 6F 67 6F 20    ogo mode..*Logo 
001CD0:  63 6F 6C 6F 72 20 30 00 09 2A 4C 6F 67 6F 20 63    color 0..*Logo c
001CE0:  6F 6C 6F 72 20 31 00 0A 2A 4C 6F 67 6F 20 63 6F    olor 1..*Logo co
001CF0:  6C 6F 72 20 32 00 0B 2A 4C 6F 67 6F 20 63 6F 6C    lor 2..*Logo col
001D00:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001D10:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001D20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001D30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001D40:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001D50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001D60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001D70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001D80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001D90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001DA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001DB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001DC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001DD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001DE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001DF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001E00:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001E10:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001E20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001E30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001E40:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001E50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001E60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001E70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001E80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001E90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001EA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001EB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001EC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001ED0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001EE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001EF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001F00:  00 46 49 56 45 20 20 20 20 46 4E 54 00 00 00 00    .FIVE    FNT....
001F10:  00 00 02 00 00 00 7D 00 00 03 00 7D 00 00 00 00    ......}....}....
001F20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001F30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001F40:  00 03 00 94 03 00 00 46 49 56 45 20 20 20 20 24    .......FIVE    $
001F50:  24 24 FF 00 FF 00 00 02 00 00 00 40 00 00 40 00    $$.........@..@.
001F60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001F70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
001F80:  00 00 00 00 00 00 00 00 18 18 18 18 18 00 18 00    ................
001F90:  6C 6C 6C 00 00 00 00 00 6C 6C FE 6C FE 6C 6C 00    lll.....ll.l.ll.
001FA0:  18 3E 58 3C 1A 7C 18 00 00 C6 CC 18 30 66 C6 00    .>X<.|......0f..
001FB0:  38 6C 38 76 DC CC 76 00 18 18 30 00 00 00 00 00    8l8v..v...0.....
001FC0:  0C 18 30 30 30 18 0C 00 30 18 0C 0C 0C 18 30 00    ..000...0.....0.
001FD0:  00 66 3C FF 3C 66 00 00 00 18 18 7E 18 18 00 00    .f<.<f.....~....
001FE0:  00 00 00 00 00 18 18 30 00 00 00 7E 00 00 00 00    .......0...~....
001FF0:  00 00 00 00 00 18 18 00 06 0C 18 30 60 C0 80 00    ...........0`...
002000:  38 6C 6C 7C 6C 6C 38 00 18 38 18 18 18 18 3C 00    8ll|ll8..8....<.
002010:  38 6C 0C 18 30 60 7C 00 38 6C 0C 18 0C 6C 38 00    8l..0`|.8l...l8.
002020:  1C 3C 6C 6C 7C 0C 0C 00 7C 60 60 78 0C 6C 38 00    .<ll|...|``x.l8.
002030:  38 6C 60 78 6C 6C 38 00 7C 6C 0C 18 30 30 30 00    8l`xll8.|l..000.
002040:  38 6C 6C 38 6C 6C 38 00 38 6C 6C 3C 0C 6C 38 00    8ll8ll8.8ll<.l8.
002050:  00 00 18 18 00 18 18 00 00 00 18 18 00 18 18 30    ...............0
002060:  0C 18 30 60 30 18 0C 00 00 00 7E 00 00 7E 00 00    ..0`0.....~..~..
002070:  60 30 18 0C 18 30 60 00 38 6C 6C 0C 18 00 18 00    `0...0`.8ll.....
002080:  30 08 38 0C 3C 6C 3C 00 38 6C 6C 6C 7C 6C 6C 00    0.8.<l<.8lll|ll.
002090:  78 6C 6C 78 6C 6C 78 00 38 6C 60 60 60 6C 38 00    xllxllx.8l```l8.
0020A0:  78 6C 6C 6C 6C 6C 78 00 7C 64 60 70 60 64 7C 00    xlllllx.|d`p`d|.
0020B0:  7C 64 60 70 60 60 60 00 38 6C 60 60 6C 64 3C 00    |d`p```.8l``ld<.
0020C0:  6C 6C 6C 7C 6C 6C 6C 00 3C 18 18 18 18 18 3C 00    lll|lll.<.....<.
0020D0:  1C 0C 0C 0C 6C 6C 38 00 6C 6C 6C 78 6C 6C 6C 00    ....ll8.lllxlll.
0020E0:  60 60 60 60 60 64 7C 00 44 6C 7C 7C 6C 6C 6C 00    `````d|.Dl||lll.
0020F0:  4C 6C 7C 7C 7C 6C 64 00 38 6C 6C 6C 6C 6C 38 00    Ll|||ld.8lllll8.
002100:  00 42 55 42 42 4C 45 20 20 47 57 58 00 00 00 00    .BUBBLE  GWX....
002110:  00 00 02 00 00 00 96 00 A0 02 00 00 00 00 00 00    ................
002120:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
002130:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
002140:  A0 02 00 BE 04 02 00 00 00 02 00 00 01 08 00 00    ................
002150:  0C 00 00 00 06 00 03 00 00 00 00 01 0F 0C 00 00    ................
002160:  00 00 00 00 00 1A 00 00 06 00 03 00 00 00 00 01    ................
002170:  0F 0C 00 00 1A 00 00 00 00 00 00 00 00 00 00 00    ................
002180:  C3 07 96 C3 3C 96 C9 21 9B 98 11 06 C2 3E 90 73    ....<..!.....>.s
002190:  23 72 23 EB 01 00 08 09 30 04 01 4A C0 09 EB 3D    #r#.....0..J...=
0021A0:  20 ED 21 06 C2 22 3B 97 AF 32 39 97 32 3A 97 32     .!..";..29.2:.2
0021B0:  37 97 3C 32 38 97 3E 3C 32 71 96 C9 2A 3B 97 11    7.<28.><2q..*;..
0021C0:  19 F0 01 FA 07 7E A2 77 23 7E A2 77 23 7E A2 77    .....~.w#~.w#~.w
0021D0:  23 7E A2 77 23 7E A2 77 23 7E A2 77 23 7E A2 77    #~.w#~.w#~.w#~.w
0021E0:  09 30 07 01 4A C0 09 01 FA 07 1D 7B 20 D7 3A 3A    .0..J......{ .::
0021F0:  97 3C 20 08 3E 3C 32 71 96 AF 18 0B FE 77 20 07    .< .><2q.....w .
002200:  3E 3D 32 71 96 3E 77 32 3A 97 21 9B 98 87 4F 06    >=2q.>w2:.!...O.
002210:  00 09 4E 23 46 3A 37 97 A7 28 2A 3A 38 97 A7 20    ..N#F:7..(*:8.. 
002220:  0E 3E 01 32 38 97 DD 21 3D 97 3A 39 97 18 40 AF    .>.28..!=.:9..@.
002230:  32 38 97 DD 21 EC 97 3A 39 97 3D 20 03 32 37 97    28..!..:9.= .27.
002240:  32 39 97 18 2A 3A 38 97 A7 28 0D AF 32 38 97 DD    29..*:8..(..28..
002250:  21 EC 97 3A 39 97 18 17 3E 01 32 38 97 DD 21 3D    !..:9...>.28..!=
002260:  97 3A 39 97 3C FE 43 20 03 32 37 97 32 39 97 6F    .:9.<.C .27.29.o
002270:  26 00 09 22 3B 97 3E 19 01 FA 07 ED 73 35 97 DD    &..";.>.....s5..
002280:  F9 08 D1 7E 83 77 23 7E 82 77 D1 23 7E 83 77 23    ...~.w#~.w.#~.w#
002290:  7E 82 77 D1 23 7E 83 77 23 7E 82 77 D1 23 7E 83    ~.w.#~.w#~.w.#~.
0022A0:  77 3B 09 30 07 01 4A C0 09 01 FA 07 08 3D 20 D1    w;.0..J......= .
0022B0:  ED 7B 35 97 C9 00 00 00 01 00 00 00 C0 00 00 07    .{5.............
0022C0:  0F 00 00 00 00 01 08 00 0C 00 00 00 06 00 00 03    ................
0022D0:  00 00 00 08 00 00 00 08 00 01 01 08 00 00 04 00    ................
0022E0:  02 03 00 00 00 02 00 02 03 00 00 00 02 00 04 06    ................
0022F0:  00 00 00 01 00 04 06 00 00 00 01 00 08 00 00 00    ................
002300:  78 6C 6C 78 60 60 60 00 38 6C 6C 64 68 6C 34 00    xllx```.8lldhl4.
002310:  78 6C 6C 78 6C 6C 6C 00 38 6C 60 38 0C 6C 38 00    xllxlll.8l`8.l8.
002320:  7C 30 30 30 30 30 30 00 6C 6C 6C 6C 6C 6C 38 00    |000000.llllll8.
002330:  6C 6C 6C 6C 6C 38 10 00 6C 6C 6C 7C 7C 6C 44 00    lllll8..lll||lD.
002340:  6C 6C 6C 38 6C 6C 6C 00 6C 6C 6C 38 30 30 30 00    lll8lll.lll8000.
002350:  7C 4C 0C 18 30 64 7C 00 3C 30 30 30 30 30 3C 00    |L..0d|.<00000<.
002360:  00 00 38 6C 60 3C 10 30 3C 0C 0C 0C 0C 0C 3C 00    ..8l`<.0<.....<.
002370:  18 24 00 00 00 00 00 00 00 00 00 00 00 00 00 FF    .$..............
002380:  30 18 0C 00 00 00 00 00 00 00 38 0C 3C 6C 3C 00    0.........8.<l<.
002390:  60 60 78 6C 6C 6C 78 00 00 00 38 6C 60 6C 38 00    ``xlllx...8l`l8.
0023A0:  0C 0C 3C 6C 6C 6C 3C 00 00 00 38 6C 7C 60 38 00    ..<lll<...8l|`8.
0023B0:  1C 30 30 78 30 30 30 00 00 00 3C 6C 6C 3C 0C 78    .00x000...<ll<.x
0023C0:  60 60 78 6C 6C 6C 6C 00 18 00 18 18 18 18 18 00    ``xllll.........
0023D0:  0C 00 0C 0C 0C 6C 6C 38 60 60 6C 6C 78 6C 6C 00    .....ll8``llxll.
0023E0:  18 18 18 18 18 18 18 00 00 00 6C 7C 7C 6C 6C 00    ..........l||ll.
0023F0:  00 00 38 6C 6C 6C 6C 00 00 00 38 6C 6C 6C 38 00    ..8llll...8lll8.
002400:  00 00 78 6C 6C 78 60 60 00 00 3C 6C 6C 3C 0C 0C    ..xllx``..<ll<..
002410:  00 00 38 6C 60 60 60 00 00 00 3C 60 38 0C 78 00    ..8l```...<`8.x.
002420:  30 30 7C 30 30 30 30 00 00 00 6C 6C 6C 6C 3C 00    00|0000...llll<.
002430:  00 00 6C 6C 6C 38 10 00 00 00 6C 6C 7C 7C 6C 00    ..lll8....ll||l.
002440:  00 00 44 6C 38 6C 44 00 00 00 6C 6C 6C 3C 0C 38    ..Dl8lD...lll<.8
002450:  00 00 7C 0C 18 30 7C 00 0C 10 38 6C 7C 60 38 00    ..|..0|...8l|`8.
002460:  30 08 6C 6C 6C 6C 3C 00 60 10 38 6C 7C 60 38 00    0.llll<.`.8l|`8.
002470:  76 DC 00 00 00 00 00 00 3C 66 60 F8 60 66 FE 00    v.......<f`.`f..
002480:  30 08 38 0C 3C 6C 3C 00 38 6C 6C 6C 7C 6C 6C 00    0.8.<l<.8lll|ll.
002490:  78 6C 6C 78 6C 6C 78 00 38 6C 60 60 60 6C 38 00    xllxllx.8l```l8.
0024A0:  78 6C 6C 6C 6C 6C 78 00 7C 64 60 70 60 64 7C 00    xlllllx.|d`p`d|.
0024B0:  7C 64 60 70 60 60 60 00 38 6C 60 60 6C 64 3C 00    |d`p```.8l``ld<.
0024C0:  6C 6C 6C 7C 6C 6C 6C 00 3C 18 18 18 18 18 3C 00    lll|lll.<.....<.
0024D0:  1C 0C 0C 0C 6C 6C 38 00 6C 6C 6C 78 6C 6C 6C 00    ....ll8.lllxlll.
0024E0:  60 60 60 60 60 64 7C 00 44 6C 7C 7C 6C 6C 6C 00    `````d|.Dl||lll.
0024F0:  4C 6C 7C 7C 7C 6C 64 00 38 6C 6C 6C 6C 6C 38 00    Ll|||ld.8lllll8.
002500:  00 00 08 08 00 00 00 00 00 08 08 00 00 00 00 00    ................
002510:  08 08 00 00 00 00 00 08 08 00 00 00 00 00 08 08    ................
002520:  00 00 00 00 00 08 08 00 00 00 00 00 08 04 00 00    ................
002530:  00 00 01 00 04 00 00 00 00 01 00 02 00 00 00 00    ................
002540:  02 00 02 00 00 00 00 02 00 01 00 00 00 00 04 00    ................
002550:  00 08 00 00 00 08 00 00 06 00 00 03 00 00 00 01    ................
002560:  08 00 0C 00 00 00 00 07 0F 00 00 00 00 00 01 0F    ................
002570:  0C 00 00 00 00 06 00 03 00 00 00 01 08 00 00 0C    ................
002580:  00 00 02 00 00 00 02 00 00 04 06 00 00 01 00 00    ................
002590:  08 0C 00 00 00 08 00 08 0C 00 00 00 08 01 01 08    ................
0025A0:  00 00 00 04 01 01 08 00 00 00 04 02 00 00 00 00    ................
0025B0:  00 02 02 00 00 00 00 00 02 02 00 00 00 00 00 02    ................
0025C0:  02 00 00 00 00 00 02 02 00 00 00 00 00 02 02 00    ................
0025D0:  00 00 00 00 02 02 00 00 00 00 00 02 01 00 00 00    ................
0025E0:  00 00 04 01 00 00 00 00 00 04 00 08 00 00 00 00    ................
0025F0:  08 00 08 00 00 00 00 08 00 04 00 00 00 01 00 00    ................
002600:  02 00 00 00 02 00 00 01 08 00 00 0C 00 00 00 06    ................
002610:  00 03 00 00 00 00 01 0F 0C 00 00 00 00 00 00 00    ................
002620:  1A 00 00 06 00 03 00 00 00 00 01 0F 0C 00 00 1A    ................
002630:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
002640:  00 40 00 BE 03 00 00 42 55 4C 4C 45 20 20 20 24    .@.....BULLE   $
002650:  24 24 FF 00 FF 00 00 02 00 00 00 40 00 00 40 00    $$.........@..@.
002660:  40 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    @...............
002670:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
002680:  F9 08 D1 7E 83 77 23 7E 82 77 D1 23 7E 83 77 23    ...~.w#~.w.#~.w#
002690:  7E 82 77 D1 23 7E 83 77 23 7E 82 77 D1 23 7E 83    ~.w.#~.w#~.w.#~.
0026A0:  77 3B 09 30 07 01 4A C0 09 01 FA 07 08 3D 20 D1    w;.0..J......= .
0026B0:  ED 7B 35 97 C9 00 00 00 01 00 00 00 C0 00 00 07    .{5.............
0026C0:  0F 00 00 00 00 01 08 00 0C 00 00 00 06 00 00 03    ................
0026D0:  00 00 00 08 00 00 00 08 00 01 01 08 00 00 04 00    ................
0026E0:  02 03 00 00 00 02 00 02 03 00 00 00 02 00 04 06    ................
0026F0:  00 00 00 01 00 04 06 00 00 00 01 00 08 00 00 00    ................
002700:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
002710:  02 00 01 00 02 09 4E E5 02 00 C1 02 00 00 00 02    ......N.........
002720:  02 00 C6 02 00 00 00 02 02 00 C2 02 00 00 00 02    ................
002730:  02 00 C7 02 00 00 00 02 02 00 C3 02 00 00 00 02    ................
002740:  02 00 C8 02 00 00 00 02 02 00 C4 02 00 00 00 02    ................
002750:  02 00 C9 02 00 00 00 02 02 00 C5 02 00 00 00 02    ................
002760:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
002770:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
002780:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
002790:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0027A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0027B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0027C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0027D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0027E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0027F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
002800:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
002810:  20 20 20 20 20 20 20 20 20 2A 20 47 68 6F 75 6C             * Ghoul
002820:  27 73 20 57 72 69 74 65 72 20 31 2E 30 20 2A 0D    's Writer 1.0 *.
002830:  0A 0D 0A 20 20 20 20 20 20 20 20 20 20 20 20 20    ...             
002840:  20 20 20 20 20 20 20 20 20 54 6F 6D 20 65 74 20             Tom et 
002850:  4A 65 72 72 79 20 6F 66 20 47 50 41 20 28 63 29    Jerry of GPA (c)
002860:  20 31 39 39 34 0D 0A 0D 0A 20 20 20 20 20 20 20     1994....       
002870:  20 20 20 20 20 20 20 20 20 20 20 20 2A 20 54 68                * Th
002880:  69 73 20 70 72 6F 67 72 61 6D 20 69 73 20 53 48    is program is SH
002890:  41 52 45 57 41 52 45 20 21 21 20 2A 20 20 20 20    AREWARE !! *    
0028A0:  0D 0A 0D 0A 0D 0A 49 20 49 6E 74 72 6F 64 75 63    ......I Introduc
0028B0:  69 6E 67 20 47 68 6F 75 6C 27 73 20 57 72 69 74    ing Ghoul's Writ
0028C0:  65 72 20 0D 0A 0D 0A 47 68 6F 75 6C 27 73 20 57    er ....Ghoul's W
0028D0:  72 69 74 65 72 20 20 69 73 20 20 61 20 20 75 74    riter  is  a  ut
0028E0:  69 6C 69 74 79 20 63 6F 6D 70 69 6C 61 74 69 6F    ility compilatio
0028F0:  6E 20 20 77 68 69 63 68 20 20 61 6C 6C 6F 77 73    n  which  allows
002900:  20 79 6F 75 20 20 74 6F 20 63 72 65 61 74 65 20     you  to create 
002910:  6C 69 74 74 6C 65 0D 0A 73 65 6C 66 2D 65 78 65    little..self-exe
002920:  63 75 74 61 62 6C 65 20 69 6E 74 72 6F 64 75 63    cutable introduc
002930:  74 69 6F 6E 73 20 77 69 74 68 6F 75 74 20 41 4E    tions without AN
002940:  54 20 50 52 4F 47 52 41 4D 4D 49 4E 47 2E 20 57    T PROGRAMMING. W
002950:  69 74 68 20 47 2E 57 2E 20 2C 20 79 6F 75 20 63    ith G.W. , you c
002960:  61 6E 20 73 65 6E 64 0D 0A 27 63 6F 6D 70 75 74    an send..'comput
002970:  65 72 20 6C 65 74 74 65 72 73 27 20 74 6F 20 79    er letters' to y
002980:  6F 75 72 20 66 72 69 65 6E 64 73 2C 20 20 6D 61    our friends,  ma
002990:  6B 65 20 61 72 74 69 63 6C 65 73 20 66 6F 72 20    ke articles for 
0029A0:  64 69 73 6B 20 66 61 6E 7A 69 6E 65 73 2C 20 65    disk fanzines, e
0029B0:  74 63 2E 2E 2E 0D 0A 43 6F 6D 70 61 72 65 64 20    tc.....Compared 
0029C0:  74 6F 20 6F 74 68 65 72 20 77 72 69 74 65 72 73    to other writers
0029D0:  20 28 47 68 6F 73 74 20 77 72 69 74 65 72 20 64     (Ghost writer d
0029E0:  65 20 4D 54 49 2C 20 4B 61 6E 67 61 72 6F 6F 27    e MTI, Kangaroo'
0029F0:  73 20 6C 65 74 74 65 72 20 63 72 65 61 74 6F 72    s letter creator
002A00:  29 61 62 20 20 20 20 20 20 3A 20 53 65 6C 65 63    )ab      : Selec
002A10:  74 20 6E 75 6D 62 65 72 20 6F 66 20 62 6C 61 6E    t number of blan
002A20:  6B 73 20 62 65 74 77 65 65 6E 20 74 77 6F 20 74    ks between two t
002A30:  61 62 75 6C 61 74 69 6F 6E 73 2E 0D 0A 20 20 20    abulations...   
002A40:  20 20 20 20 28 4F 29 70 65 6E 20 20 20 20 20 3A        (O)pen     :
002A50:  20 4C 6F 61 64 20 61 20 74 65 78 74 20 74 79 70     Load a text typ
002A60:  65 64 20 77 69 74 68 20 47 57 45 44 49 54 20 28    ed with GWEDIT (
002A70:  6F 6E 6C 79 20 2E 47 57 54 20 66 6F 72 6D 61 74    only .GWT format
002A80:  29 2E 0D 0A 20 20 20 20 20 20 20 28 53 29 61 76    )...       (S)av
002A90:  65 20 20 20 20 20 3A 20 73 61 76 65 20 61 20 2E    e     : save a .
002AA0:  47 57 54 20 66 6F 72 6D 61 74 20 74 65 78 74 2E    GWT format text.
002AB0:  0D 0A 20 20 20 20 20 20 20 28 43 29 6F 6E 76 65    ..       (C)onve
002AC0:  72 74 20 20 3A 20 63 6F 6E 76 65 72 74 20 61 6E    rt  : convert an
002AD0:  64 20 73 61 76 65 20 61 20 43 6F 6D 70 72 65 73    d save a Compres
002AE0:  73 65 64 20 66 69 6C 65 20 28 2E 47 57 43 20 66    sed file (.GWC f
002AF0:  6F 72 6D 61 74 29 2E 20 4F 6E 6C 79 20 74 68 69    ormat). Only thi
002B00:  73 0D 0A 20 20 20 20 20 20 20 20 20 20 20 20 20    s..             
002B10:  20 20 20 20 20 20 20 6B 69 6E 64 20 6F 66 20 66           kind of f
002B20:  69 6C 65 20 63 61 6E 20 62 65 20 75 73 65 64 20    ile can be used 
002B30:  77 69 74 68 20 74 68 65 20 6C 69 6E 6B 65 72 2E    with the linker.
002B40:  0D 0A 20 20 20 20 20 20 20 20 20 20 20 20 20 20    ..              
002B50:  20 20 20 20 20 20 57 61 72 6E 69 6E 67 20 21 20          Warning ! 
002B60:  43 6F 6E 76 65 72 74 20 63 6F 6D 6D 61 6E 64 20    Convert command 
002B70:  64 65 6C 65 74 65 73 20 74 65 78 74 20 69 6E 20    deletes text in 
002B80:  6D 65 6D 6F 72 79 2E 0D 0A 20 20 20 20 20 20 20    memory...       
002B90:  28 46 29 69 6C 65 6E 61 6D 65 20 3A 20 47 69 76    (F)ilename : Giv
002BA0:  65 20 61 20 6E 61 6D 65 20 74 6F 20 74 68 65 20    e a name to the 
002BB0:  64 65 66 61 75 6C 74 20 20 74 65 78 74 20 28 6E    default  text (n
002BC0:  65 77 20 20 74 65 78 74 20 6F 72 20 74 65 78 74    ew  text or text
002BD0:  20 6C 6F 61 64 65 64 0D 0A 20 20 20 20 20 20 20     loaded..       
002BE0:  20 20 20 20 20 20 20 20 20 20 20 20 20 66 72 6F                 fro
002BF0:  6D 20 64 69 73 6B 29 2E 20 59 6F 75 20 6D 75 73    m disk). You mus
002C00:  29 2C 20 47 2E 57 0D 0A 69 6E 63 6C 75 64 65 73    ), G.W..includes
002C10:  20 6D 61 6E 79 20 6F 70 74 69 6F 6E 73 20 74 6F     many options to
002C20:  20 67 69 76 65 20 61 20 70 65 72 73 6F 6E 61 6C     give a personal
002C30:  20 74 6F 75 63 68 20 74 6F 20 79 6F 75 72 20 69     touch to your i
002C40:  6E 74 72 6F 73 20 28 79 6F 75 20 63 61 6E 20 75    ntros (you can u
002C50:  73 65 20 79 6F 75 72 0D 0A 6F 77 6E 20 6D 75 73    se your..own mus
002C60:  69 63 73 2C 20 67 72 61 70 68 69 63 73 2C 20 65    ics, graphics, e
002C70:  74 63 2E 2E 20 29 2E 0D 0A 0D 0A 45 61 63 68 20    tc.. ).....Each 
002C80:  69 6E 74 72 6F 20 66 69 6C 65 20 62 75 69 6C 74    intro file built
002C90:  20 77 69 74 68 20 47 2E 57 2E 20 69 73 20 61 20     with G.W. is a 
002CA0:  61 73 73 65 6D 62 6C 69 6E 67 20 6F 66 20 64 61    assembling of da
002CB0:  74 61 20 66 69 6C 65 73 20 3A 0D 0A 0D 0A 20 20    ta files :....  
002CC0:  20 20 20 20 20 20 2A 20 61 20 53 6F 75 6E 64 74          * a Soundt
002CD0:  72 61 6B 6B 65 72 20 6D 75 73 69 63 0D 0A 20 20    rakker music..  
002CE0:  20 20 20 20 20 20 2A 20 61 6E 20 4F 43 50 20 61          * an OCP a
002CF0:  72 74 20 73 74 75 64 69 6F 20 66 6F 72 6D 61 74    rt studio format
002D00:  20 63 68 61 72 73 65 74 0D 0A 20 20 20 20 20 20     charset..      
002D10:  20 20 2A 20 61 20 54 65 78 74 20 74 79 70 65 64      * a Text typed
002D20:  20 77 69 74 68 20 47 57 45 44 49 54 0D 0A 20 20     with GWEDIT..  
002D30:  20 20 20 20 20 20 2A 20 61 20 4C 6F 67 6F 0D 0A          * a Logo..
002D40:  20 20 20 20 20 20 20 20 2A 20 61 20 63 6C 65 61            * a clea
002D50:  72 73 63 72 65 65 6E 20 6D 65 74 68 6F 64 0D 0A    rscreen method..
002D60:  20 20 20 20 20 20 20 20 2A 20 61 6E 20 61 6E 69            * an ani
002D70:  6D 61 74 69 6F 6E 20 28 6F 6E 6C 79 20 66 6F 72    mation (only for
002D80:  20 4D 6F 64 65 20 31 20 74 65 78 74 29 0D 0A 0D     Mode 1 text)...
002D90:  0A 57 68 65 6E 20 69 6E 74 72 6F 20 20 66 69 6C    .When intro  fil
002DA0:  65 73 20 61 72 65 20 6C 6F 61 64 65 64 20 20 69    es are loaded  i
002DB0:  6E 20 74 68 65 20 4C 69 6E 6B 20 70 72 6F 67 72    n the Link progr
002DC0:  61 6D 2C 20 20 79 6F 75 20 63 61 6E 20 61 6C 73    am,  you can als
002DD0:  6F 20 63 68 61 6E 67 65 20 6F 74 68 65 72 0D 0A    o change other..
002DE0:  70 61 72 61 6D 65 74 65 72 73 2E 0D 0A 0D 0A 20    parameters..... 
002DF0:  20 20 20 20 20 20 20 2A 20 6C 6F 67 6F 20 6D 6F           * logo mo
002E00:  74 20 6E 61 6D 65 20 61 20 74 65 78 74 20 62 65    t name a text be
002E10:  66 6F 72 65 20 73 61 76 69 6E 67 20 6F 72 20 63    fore saving or c
002E20:  6F 6E 76 65 72 2D 0D 0A 20 20 20 20 20 20 20 20    onver-..        
002E30:  20 20 20 20 20 20 20 20 20 20 20 20 74 69 6E 67                ting
002E40:  20 69 74 2E 0D 0A 20 20 20 20 20 20 20 28 44 29     it...       (D)
002E50:  69 72 20 20 20 20 20 20 3A 20 64 69 73 6B 65 74    ir      : disket
002E60:  74 65 20 64 69 72 65 63 74 6F 72 79 20 28 6F 6E    te directory (on
002E70:  6C 79 20 2E 47 57 54 20 66 69 6C 65 73 20 61 72    ly .GWT files ar
002E80:  65 20 70 72 69 6E 74 65 64 20 6F 6E 20 73 63 72    e printed on scr
002E90:  65 65 6E 29 2E 0D 0A 20 20 20 20 20 20 20 28 41    een)...       (A
002EA0:  29 3A 20 20 20 20 20 20 20 3A 20 73 65 6C 65 63    ):       : selec
002EB0:  74 20 41 3A 20 64 72 69 76 65 20 61 73 20 77 6F    t A: drive as wo
002EC0:  72 6B 69 6E 67 20 64 72 69 76 65 2E 0D 0A 20 20    rking drive...  
002ED0:  20 20 20 20 20 28 42 29 3A 20 20 20 20 20 20 20         (B):       
002EE0:  3A 20 73 65 6C 65 63 74 20 42 3A 20 64 72 69 76    : select B: driv
002EF0:  65 20 61 73 20 77 6F 72 6B 69 6E 67 20 64 72 69    e as working dri
002F00:  76 65 2E 0D 0A 0D 0A 20 20 20 20 45 64 69 74 6F    ve.....    Edito
002F10:  72 27 73 20 63 6F 6D 6D 61 6E 64 73 20 3A 0D 0A    r's commands :..
002F20:  0D 0A 20 20 20 20 20 20 20 28 45 53 43 29 20 20    ..       (ESC)  
002F30:  20 20 20 20 20 20 20 20 20 20 20 3A 20 67 6F 20               : go 
002F40:  74 6F 20 6D 61 69 6E 20 6D 65 6E 75 2E 0D 0A 20    to main menu... 
002F50:  20 20 20 20 20 20 28 52 45 54 55 52 4E 29 20 20          (RETURN)  
002F60:  20 20 20 20 20 20 20 20 3A 20 63 75 72 73 6F 72            : cursor
002F70:  20 67 6F 65 73 20 74 6F 20 74 68 65 20 62 65 67     goes to the beg
002F80:  69 6E 6E 69 6E 67 20 6F 66 20 6E 65 78 74 20 6C    inning of next l
002F90:  69 6E 65 2E 0D 0A 20 20 20 20 20 20 20 28 43 4F    ine...       (CO
002FA0:  50 59 29 20 20 20 20 20 20 20 20 20 20 20 20 3A    PY)            :
002FB0:  20 49 6E 73 65 72 74 20 61 20 63 68 61 72 20 6F     Insert a char o
002FC0:  6E 20 61 20 6C 69 6E 65 2E 0D 0A 20 20 20 20 20    n a line...     
002FD0:  20 20 28 44 45 4C 29 20 26 20 28 43 4C 52 29 20      (DEL) & (CLR) 
002FE0:  20 20 20 20 3A 20 44 65 6C 65 74 65 20 61 20 63        : Delete a c
002FF0:  68 61 72 20 6F 6E 20 61 20 6C 69 6E 65 2E 0D 0A    har on a line...
003000:  64 65 20 28 31 20 6F 75 20 32 29 0D 0A 20 20 20    de (1 ou 2)..   
003010:  20 20 20 20 20 2A 20 63 6F 6C 6F 72 73 20 6F 66         * colors of
003020:  20 6C 6F 67 6F 2C 20 6F 66 20 63 68 61 72 73 65     logo, of charse
003030:  74 2C 20 65 74 63 2E 2E 0D 0A 20 20 20 20 20 20    t, etc....      
003040:  20 20 2A 20 63 75 72 73 6F 72 20 70 72 69 6E 74      * cursor print
003050:  69 6E 67 0D 0A 20 20 20 20 20 20 20 20 2A 20 74    ing..        * t
003060:  65 78 74 20 70 72 69 6E 74 69 6E 67 20 73 70 65    ext printing spe
003070:  65 64 0D 0A 20 20 20 20 20 20 20 20 2A 20 6D 65    ed..        * me
003080:  73 73 61 67 65 20 27 50 72 65 73 73 20 73 70 61    ssage 'Press spa
003090:  63 65 20 74 6F 20 63 6F 6E 74 69 6E 75 65 27 20    ce to continue' 
0030A0:  69 6E 20 74 68 65 20 62 61 63 6B 20 6F 66 20 74    in the back of t
0030B0:  68 65 20 73 63 72 65 65 6E 0D 0A 0D 0A 4C 65 74    he screen....Let
0030C0:  27 73 20 73 65 65 20 77 68 61 74 20 74 68 65 20    's see what the 
0030D0:  75 74 69 6C 69 74 69 65 73 20 6F 66 20 47 2E 57    utilities of G.W
0030E0:  20 61 72 65 20 21 0D 0A 0D 0A 20 20 20 20 20 20     are !....      
0030F0:  20 20 2A 20 61 6E 20 65 61 73 79 20 74 6F 20 75      * an easy to u
003100:  73 65 20 74 65 78 74 20 65 64 69 74 6F 72 2C 20    se text editor, 
003110:  77 68 69 63 68 20 6D 61 6B 65 73 20 47 68 6F 75    which makes Ghou
003120:  6C 27 73 20 57 72 69 74 65 72 20 74 65 78 74 20    l's Writer text 
003130:  66 69 6C 65 73 0D 0A 20 20 20 20 20 20 20 20 2A    files..        *
003140:  20 61 20 6C 69 6E 6B 65 72 20 77 68 69 63 68 20     a linker which 
003150:  63 72 65 61 74 65 73 20 74 68 65 20 69 6E 74 72    creates the intr
003160:  6F 20 66 69 6C 65 0D 0A 20 20 20 20 20 20 20 20    o file..        
003170:  2A 20 61 20 53 6F 75 6E 64 74 72 61 6B 6B 65 72    * a Soundtrakker
003180:  27 73 20 6D 75 73 69 63 20 72 65 6C 6F 63 61 74    's music relocat
003190:  6F 72 0D 0A 20 20 20 20 20 20 20 20 2A 20 61 20    or..        * a 
0031A0:  6C 6F 67 6F 20 66 69 6C 65 20 6D 61 6B 65 72 0D    logo file maker.
0031B0:  0A 20 20 20 20 20 20 20 20 2A 20 61 20 2E 46 4E    .        * a .FN
0031C0:  54 20 63 68 61 72 73 65 74 20 66 69 6C 65 20 6D    T charset file m
0031D0:  61 6B 65 72 20 77 69 74 68 20 42 61 73 69 63 20    aker with Basic 
0031E0:  66 6F 6E 74 73 0D 0A 0D 0A 41 6C 6C 20 74 68 65    fonts....All the
0031F0:  73 65 20 75 74 69 6C 69 74 69 65 73 20 77 69 6C    se utilities wil
003200:  20 20 20 20 20 20 20 28 54 41 42 29 20 20 20 20           (TAB)    
003210:  20 20 20 20 20 20 20 20 20 3A 20 6D 6F 76 65 20             : move 
003220:  63 75 72 73 6F 72 20 66 72 6F 6D 20 58 20 63 68    cursor from X ch
003230:  61 72 73 2E 0D 0A 20 20 20 20 20 20 20 28 53 48    ars...       (SH
003240:  49 46 54 29 20 2B 20 28 4C 45 46 54 29 20 20 3A    IFT) + (LEFT)  :
003250:  20 49 6E 73 65 72 74 20 61 20 63 68 61 72 20 69     Insert a char i
003260:  6E 20 74 68 65 20 74 65 78 74 2E 0D 0A 20 20 20    n the text...   
003270:  20 20 20 20 28 53 48 49 46 54 29 20 2B 20 28 52        (SHIFT) + (R
003280:  49 47 48 54 29 20 3A 20 44 65 6C 65 74 65 20 61    IGHT) : Delete a
003290:  20 63 68 61 72 20 69 6E 20 74 68 65 20 74 65 78     char in the tex
0032A0:  74 2E 0D 0A 20 20 20 20 20 20 20 28 53 48 49 46    t...       (SHIF
0032B0:  54 29 20 2B 20 28 55 50 29 20 20 20 20 3A 20 45    T) + (UP)    : E
0032C0:  72 61 73 65 20 61 20 6C 69 6E 65 2E 0D 0A 20 20    rase a line...  
0032D0:  20 20 20 20 20 28 53 48 49 46 54 29 20 2B 20 28         (SHIFT) + (
0032E0:  44 4F 57 4E 29 20 20 3A 20 49 6E 73 65 72 74 20    DOWN)  : Insert 
0032F0:  61 20 62 6C 61 6E 6B 20 6C 69 6E 65 2E 0D 0A 20    a blank line... 
003300:  20 20 20 20 20 20 28 43 54 52 4C 29 20 20 2B 20          (CTRL)  + 
003310:  28 4C 45 46 54 29 20 20 3A 20 50 72 65 76 69 6F    (LEFT)  : Previo
003320:  75 73 20 70 61 67 65 2E 0D 0A 20 20 20 20 20 20    us page...      
003330:  20 28 43 54 52 4C 29 20 20 2B 20 28 52 49 47 48     (CTRL)  + (RIGH
003340:  54 29 20 3A 20 4E 65 78 74 20 70 61 67 65 2E 0D    T) : Next page..
003350:  0A 20 20 20 20 20 20 20 28 43 55 52 53 4F 52 20    .       (CURSOR 
003360:  4B 45 59 53 29 20 20 20 20 20 3A 20 6D 6F 76 65    KEYS)     : move
003370:  20 63 75 72 73 6F 72 2E 0D 0A 20 20 20 20 20 20     cursor...      
003380:  20 28 46 30 29 20 61 20 28 46 39 29 20 20 20 20     (F0) a (F9)    
003390:  20 20 20 3A 20 70 72 69 6E 74 20 61 20 73 70 65       : print a spe
0033A0:  63 69 61 6C 20 63 68 61 72 20 28 31 32 39 20 74    cial char (129 t
0033B0:  6F 20 31 33 39 29 2E 0D 0A 0D 0A 20 20 20 20 20    o 139).....     
0033C0:  20 20 20 0D 0A 32 29 20 47 57 45 44 49 54 20 69       ..2) GWEDIT i
0033D0:  6E 66 6F 72 6D 61 74 69 6F 6E 73 20 3A 0D 0A 0D    nformations :...
0033E0:  0A 20 20 20 47 77 65 64 69 74 20 63 61 6E 20 70    .   Gwedit can p
0033F0:  72 6F 64 75 63 65 20 74 65 78 74 73 20 6F 66 20    roduce texts of 
003400:  6C 20 62 65 20 64 65 73 63 72 69 62 65 64 20 69    l be described i
003410:  6E 20 74 68 69 73 20 75 73 65 72 27 73 20 6D 61    n this user's ma
003420:  6E 75 61 6C 2E 20 5A 38 30 20 63 6F 64 65 72 73    nual. Z80 coders
003430:  20 77 69 6C 6C 0D 0A 66 69 6E 64 20 73 6F 6D 65     will..find some
003440:  20 77 6F 72 64 73 20 20 61 62 6F 75 74 20 64 61     words  about da
003450:  74 61 66 69 6C 65 73 20 20 20 73 74 72 75 63 74    tafiles   struct
003460:  75 72 65 73 20 61 74 20 74 68 65 20 65 6E 64 20    ures at the end 
003470:  20 6F 66 20 74 68 65 20 74 65 78 74 2E 20 20 54     of the text.  T
003480:  68 65 79 0D 0A 63 6F 75 6C 64 20 6D 61 6B 65 20    hey..could make 
003490:  74 68 65 69 72 20 6F 77 6E 20 6C 69 62 72 61 72    their own librar
0034A0:  69 65 73 20 6F 66 20 6D 75 73 69 63 73 2C 20 6C    ies of musics, l
0034B0:  6F 67 6F 73 2C 20 65 74 63 2E 2E 2E 0D 0A 0D 0A    ogos, etc.......
0034C0:  52 75 6E 20 74 68 65 20 66 69 6C 65 20 2D 47 57    Run the file -GW
0034D0:  44 45 4D 4F 2E 42 49 4E 20 6A 75 73 74 20 74 6F    DEMO.BIN just to
0034E0:  20 73 65 65 20 77 68 61 74 20 77 65 20 63 61 6E     see what we can
0034F0:  20 64 6F 20 69 6E 20 74 77 6F 20 6D 69 6E 75 74     do in two minut
003500:  65 73 20 77 69 74 68 20 47 2E 57 20 21 0D 0A 0D    es with G.W !...
003510:  0A 0D 0A 49 49 20 47 57 45 44 49 54 2C 20 74 68    ...II GWEDIT, th
003520:  65 20 74 65 78 74 20 65 64 69 74 6F 72 0D 0A 0D    e text editor...
003530:  0A 57 68 65 6E 20 49 20 77 61 73 20 63 6F 64 69    .When I was codi
003540:  6E 67 20 47 68 6F 75 6C 27 73 20 57 72 69 74 65    ng Ghoul's Write
003550:  72 2C 20 20 49 20 66 61 63 65 64 20 61 20 70 72    r,  I faced a pr
003560:  6F 62 6C 65 6D 20 3A 20 53 68 6F 75 6C 64 20 47    oblem : Should G
003570:  2E 57 2E 20 20 75 73 65 20 74 65 78 74 73 0D 0A    .W.  use texts..
003580:  74 79 70 65 64 20 77 69 74 68 20 77 6F 72 64 20    typed with word 
003590:  70 72 6F 63 65 73 73 6F 72 73 20 6F 72 20 77 69    processors or wi
0035A0:  74 68 20 61 20 73 70 65 63 69 61 6C 20 65 64 69    th a special edi
0035B0:  74 6F 72 20 3F 20 20 41 73 20 74 68 65 72 65 20    tor ?  As there 
0035C0:  61 72 65 20 6D 61 6E 79 20 77 6F 72 64 0D 0A 70    are many word..p
0035D0:  72 6F 63 65 73 73 6F 72 73 20 6F 6E 20 43 50 43    rocessors on CPC
0035E0:  20 28 50 72 6F 74 65 78 74 2C 20 53 65 6D 77 6F     (Protext, Semwo
0035F0:  72 64 2C 20 41 6D 73 77 6F 72 64 2C 20 65 74 63    rd, Amsword, etc
003600:  31 39 20 70 61 67 65 73 20 69 6E 20 6D 6F 64 65    19 pages in mode
003610:  20 32 20 6F 72 20 33 38 20 70 61 67 65 73 20 69     2 or 38 pages i
003620:  6E 20 6D 6F 64 65 20 31 2E 20 54 77 6F 0D 0A 20    n mode 1. Two.. 
003630:  20 20 74 65 78 74 20 73 74 72 75 63 74 75 72 65      text structure
003640:  73 20 61 72 65 20 75 73 65 64 20 69 6E 20 47 57    s are used in GW
003650:  45 44 49 54 20 3A 0D 0A 0D 0A 20 20 20 20 20 20    EDIT :....      
003660:  20 2A 20 54 65 78 74 20 66 6F 72 6D 61 74 20 28     * Text format (
003670:  2E 47 57 54 20 65 78 74 65 6E 73 69 6F 6E 29 20    .GWT extension) 
003680:  3A 0D 0A 0D 0A 20 20 20 20 20 20 20 20 20 54 68    :....         Th
003690:  69 73 20 74 65 78 74 20 73 74 72 75 63 74 75 72    is text structur
0036A0:  65 20 64 6F 65 73 6E 27 74 20 75 73 65 20 61 6E    e doesn't use an
0036B0:  79 20 63 6F 6E 74 72 6F 6C 20 63 68 61 72 2E 20    y control char. 
0036C0:  4F 6E 6C 79 20 74 68 65 20 66 69 72 73 74 20 20    Only the first  
0036D0:  62 79 74 65 0D 0A 20 20 20 20 20 20 20 20 20 6F    byte..         o
0036E0:  66 20 74 68 65 20 74 65 78 74 20 20 68 61 73 20    f the text  has 
0036F0:  61 20 73 70 65 63 69 61 6C 20 6D 65 61 6E 69 6E    a special meanin
003700:  67 20 3A 20 20 69 74 73 20 6D 6F 64 65 20 28 6D    g :  its mode (m
003710:  6F 64 65 20 31 2C 20 33 37 20 63 6F 6C 75 6D 6E    ode 1, 37 column
003720:  73 20 20 6F 72 0D 0A 20 20 20 20 20 20 20 20 20    s  or..         
003730:  6D 6F 64 65 20 32 2C 20 37 38 20 63 6F 6C 75 6D    mode 2, 78 colum
003740:  6E 73 29 2E 20 20 45 61 63 68 20 62 6C 61 6E 6B    ns).  Each blank
003750:  20 69 73 20 63 6F 64 65 64 20 77 69 74 68 20 74     is coded with t
003760:  68 65 20 41 53 43 49 49 20 63 68 61 72 20 33 32    he ASCII char 32
003770:  2E 20 20 59 6F 75 0D 0A 20 20 20 20 20 20 20 20    .  You..        
003780:  20 6D 61 79 20 6E 6F 77 20 75 6E 64 65 72 73 74     may now underst
003790:  61 6E 64 20 77 68 79 20 2E 47 57 54 20 74 65 78    and why .GWT tex
0037A0:  74 20 61 72 65 20 73 6F 20 6C 6F 6E 67 2E 20 57    t are so long. W
0037B0:  68 79 20 73 75 63 68 20 61 20 73 69 6D 70 6C 65    hy such a simple
0037C0:  20 73 74 72 75 63 2D 0D 0A 20 20 20 20 20 20 20     struc-..       
0037D0:  20 20 74 75 72 65 20 3F 20 54 6F 20 75 73 65 20      ture ? To use 
0037E0:  47 57 45 44 49 54 20 61 73 20 61 20 73 63 72 6F    GWEDIT as a scro
0037F0:  6C 6C 74 65 78 74 20 77 72 69 74 65 72 20 28 67    lltext writer (g
003800:  2E 2E 2E 20 20 29 2C 20 49 20 66 69 6E 61 6C 6C    ...  ), I finall
003810:  79 20 64 65 63 69 64 65 64 20 74 6F 0D 0A 77 72    y decided to..wr
003820:  69 74 65 20 6D 79 20 6F 77 6E 20 74 65 78 74 20    ite my own text 
003830:  65 64 69 74 6F 72 2E 20 49 74 20 69 73 20 6E 6F    editor. It is no
003840:  74 20 61 20 67 72 65 61 74 20 70 69 65 63 65 20    t a great piece 
003850:  6F 66 20 73 6F 66 74 77 61 72 65 2C 20 62 75 74    of software, but
003860:  20 69 74 20 68 61 73 20 74 68 65 0D 0A 75 73 75     it has the..usu
003870:  61 6C 20 62 61 73 69 63 20 66 75 6E 63 74 69 6F    al basic functio
003880:  6E 73 20 74 6F 20 74 79 70 65 20 61 20 74 65 78    ns to type a tex
003890:  74 20 65 61 73 69 6C 79 2E 0D 0A 0D 0A 31 29 20    t easily.....1) 
0038A0:  47 57 45 44 49 54 20 63 6F 6D 6D 61 6E 64 73 0D    GWEDIT commands.
0038B0:  0A 0D 0A 20 20 20 4D 61 69 6E 20 6D 65 6E 75 20    ...   Main menu 
0038C0:  63 6F 6D 6D 61 6E 64 73 20 3A 0D 0A 0D 0A 20 20    commands :....  
0038D0:  20 20 20 20 20 28 4E 29 65 77 20 74 65 78 74 20         (N)ew text 
0038E0:  3A 20 43 72 65 61 74 65 20 61 20 6E 65 77 20 74    : Create a new t
0038F0:  65 78 74 2E 20 49 66 20 61 6E 20 6F 6C 64 20 6F    ext. If an old o
003900:  6E 65 20 69 73 20 69 6E 20 6D 65 6D 6F 72 79 2C    ne is in memory,
003910:  20 69 74 20 77 69 6C 6C 20 62 65 0D 0A 20 20 20     it will be..   
003920:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
003930:  20 65 72 61 73 65 64 2E 20 20 57 68 65 6E 20 79     erased.  When y
003940:  6F 75 20 73 74 61 72 74 20 20 61 20 6E 65 77 20    ou start  a new 
003950:  74 65 78 74 2C 20 20 79 6F 75 20 6D 75 73 74 20    text,  you must 
003960:  63 68 6F 6F 73 65 20 69 74 73 0D 0A 20 20 20 20    choose its..    
003970:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
003980:  64 69 73 70 6C 61 79 20 6D 6F 64 65 20 28 6D 6F    display mode (mo
003990:  64 65 20 31 20 6F 72 20 32 29 2E 0D 0A 20 20 20    de 1 or 2)...   
0039A0:  20 20 20 20 28 45 29 64 69 74 20 20 20 20 20 3A        (E)dit     :
0039B0:  20 65 64 69 74 20 74 65 78 74 20 69 6E 20 6D 65     edit text in me
0039C0:  6D 6F 72 79 2E 0D 0A 20 20 20 20 20 20 20 28 48    mory...       (H
0039D0:  29 65 6C 70 20 20 20 20 20 3A 20 6C 69 73 74 20    )elp     : list 
0039E0:  6F 66 20 65 64 69 74 6F 72 27 73 20 63 6F 6D 6D    of editor's comm
0039F0:  61 6E 64 73 2E 0D 0A 20 20 20 20 20 20 20 28 54    ands...       (T
003A00:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
003A10:  03 00 01 00 02 09 4E E5 03 00 C1 02 00 00 00 02    ......N.........
003A20:  03 00 C6 02 00 00 00 02 03 00 C2 02 00 00 00 02    ................
003A30:  03 00 C7 02 00 00 00 02 03 00 C3 02 00 00 00 02    ................
003A40:  03 00 C8 02 00 00 00 02 03 00 C4 02 00 00 00 02    ................
003A50:  03 00 C9 02 00 00 00 02 03 00 C5 02 00 00 00 02    ................
003A60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
003A70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
003A80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
003A90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
003AA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
003AB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
003AC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
003AD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
003AE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
003AF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
003B00:  72 65 61 74 20 66 6F 72 20 74 79 70 69 6E 67 20    reat for typing 
003B10:  20 74 65 78 74 20 6F 66 0D 0A 20 20 20 20 20 20     text of..      
003B20:  20 20 20 64 65 6D 6F 73 20 21 29 2E 0D 0A 0D 0A       demos !).....
003B30:  20 20 20 20 20 20 20 2A 20 43 6F 6D 70 72 65 73           * Compres
003B40:  73 65 64 20 66 6F 72 6D 61 74 20 28 2E 47 57 43    sed format (.GWC
003B50:  20 65 78 74 65 6E 73 69 6F 6E 29 20 3A 0D 0A 0D     extension) :...
003B60:  0A 20 20 20 20 20 20 20 20 20 42 61 73 65 64 20    .         Based 
003B70:  6F 6E 20 61 20 2E 47 57 54 20 74 65 78 74 20 20    on a .GWT text  
003B80:  66 6F 72 6D 61 74 2C 20 20 74 68 69 73 20 73 74    format,  this st
003B90:  72 75 63 74 75 72 65 20 63 6F 6E 74 61 69 6E 73    ructure contains
003BA0:  20 20 20 73 6F 6D 65 20 63 6F 6E 74 72 6F 6C 0D       some control.
003BB0:  0A 20 20 20 20 20 20 20 20 20 63 68 61 72 73 20    .         chars 
003BC0:  74 6F 20 73 68 6F 72 74 65 6E 20 69 74 2E 20 20    to shorten it.  
003BD0:  57 61 72 6E 69 6E 67 20 21 20 47 57 45 44 49 54    Warning ! GWEDIT
003BE0:  20 63 61 6E 27 74 20 72 65 61 64 20 74 68 69 73     can't read this
003BF0:  20 20 6B 69 6E 64 20 6F 66 20 74 65 78 74 2E 0D      kind of text..
003C00:  0A 20 20 20 20 20 20 20 20 20 53 6F 2C 20 6D 61    .         So, ma
003C10:  6B 65 20 61 20 54 65 78 74 20 66 6F 72 6D 61 74    ke a Text format
003C20:  20 63 6F 70 79 20 6F 66 20 79 6F 75 72 20 74 65     copy of your te
003C30:  78 74 20 62 65 66 6F 72 65 20 63 6F 6E 76 65 72    xt before conver
003C40:  74 69 6E 67 20 20 69 74 20 21 0D 0A 0D 0A 20 20    ting  it !....  
003C50:  20 20 54 6F 20 62 72 69 67 68 74 65 6E 20 75 70      To brighten up
003C60:  20 61 20 74 65 78 74 2C 20 69 74 20 69 73 20 70     a text, it is p
003C70:  6F 73 73 69 62 6C 65 20 74 6F 20 67 69 76 65 6E    ossible to given
003C80:  20 6F 75 74 20 20 73 70 65 63 69 61 6C 20 63 68     out  special ch
003C90:  61 72 73 2C 20 77 69 74 68 20 74 68 65 0D 0A 20    ars, with the.. 
003CA0:  20 20 20 6B 65 79 73 20 46 30 20 74 6F 20 46 39       keys F0 to F9
003CB0:  2E 20 45 76 65 6E 74 75 61 6C 79 2C 20 79 6F 75    . Eventualy, you
003CC0:  20 63 61 6E 20 64 65 73 69 67 6E 20 79 6F 75 72     can design your
003CD0:  20 6F 77 6E 20 63 68 61 72 73 2C 20 20 63 68 61     own chars,  cha
003CE0:  6E 67 69 6E 67 20 74 68 65 20 66 69 6C 65 0D 0A    nging the file..
003CF0:  20 20 20 20 4D 4F 52 45 2D 43 48 41 52 2E 44 41        MORE-CHAR.DA
003D00:  20 49 6E 20 74 68 65 20 63 6F 6E 66 69 67 75 72     In the configur
003D10:  61 74 69 6F 6E 20 73 63 72 65 65 6E 2C 20 27 54    ation screen, 'T
003D20:  65 78 74 20 73 70 65 65 64 27 20 66 75 6E 63 74    ext speed' funct
003D30:  69 6F 6E 20 69 73 20 64 69 73 61 62 6C 65 64 20    ion is disabled 
003D40:  77 68 65 6E 20 74 68 65 0D 0A 20 20 20 63 75 72    when the..   cur
003D50:  73 6F 72 20 69 73 20 73 65 6C 65 63 74 65 64 2E    sor is selected.
003D60:  20 57 68 65 6E 20 61 63 74 69 76 65 2C 20 74 68     When active, th
003D70:  69 73 20 6F 70 74 69 6F 6E 20 64 6F 75 62 6C 65    is option double
003D80:  73 20 20 74 68 65 20 73 70 65 65 64 20 6F 66 20    s  the speed of 
003D90:  63 68 61 72 0D 0A 20 20 20 64 69 73 70 6C 61 79    char..   display
003DA0:  2E 20 54 68 69 73 20 69 73 20 72 65 61 6C 6C 79    . This is really
003DB0:  20 69 6E 74 65 72 65 73 74 69 6E 67 20 77 68 65     interesting whe
003DC0:  6E 20 79 6F 75 20 77 72 69 74 65 20 6D 65 73 73    n you write mess
003DD0:  61 67 65 73 20 69 6E 20 6D 6F 64 65 20 32 2E 0D    ages in mode 2..
003DE0:  0A 20 20 0D 0A 20 20 20 57 68 65 6E 20 79 6F 75    .  ..   When you
003DF0:  20 73 61 76 65 20 61 6E 20 69 6E 74 72 6F 2C 20     save an intro, 
003E00:  74 68 65 20 66 69 6C 65 20 63 72 65 61 74 65 64    the file created
003E10:  20 77 69 6C 6C 20 68 61 76 65 20 74 68 65 73 65     will have these
003E20:  20 63 68 61 72 61 63 74 65 72 73 20 3A 0D 0A 0D     characters :...
003E30:  0A 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20    .               
003E40:  20 2A 20 6C 6F 61 64 69 6E 67 20 61 64 64 72 65     * loading addre
003E50:  73 73 20 20 20 20 20 20 20 20 3A 20 63 68 61 6E    ss        : chan
003E60:  67 65 61 62 6C 65 0D 0A 20 20 20 20 20 20 20 20    geable..        
003E70:  20 20 20 20 20 20 20 20 2A 20 45 6E 74 72 79 20            * Entry 
003E80:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
003E90:  20 3A 20 26 39 30 30 30 0D 0A 20 20 20 20 20 20     : &9000..      
003EA0:  20 20 20 20 20 20 20 20 20 20 2A 20 4C 65 6E 67              * Leng
003EB0:  74 68 20 20 20 20 20 20 20 20 20 20 20 20 20 20    th              
003EC0:  20 20 20 3A 20 63 68 61 6E 67 65 61 62 6C 65 0D       : changeable.
003ED0:  0A 0D 0A 20 20 20 54 68 69 73 20 69 6E 74 72 6F    ...   This intro
003EE0:  20 63 61 6E 20 62 65 20 6C 6F 61 64 65 64 20 69     can be loaded i
003EF0:  6E 20 6D 65 6D 6F 72 79 20 61 6E 64 20 6C 61 75    n memory and lau
003F00:  54 20 62 79 20 61 6E 6F 74 68 65 72 20 6F 6E 65    T by another one
003F10:  20 20 69 6E 20 74 68 65 20 45 64 69 74 6F 72 27      in the Editor'
003F20:  73 20 20 61 6E 64 20 4C 69 6E 6B 65 72 27 73 20    s  and Linker's 
003F30:  20 42 61 73 69 63 20 6C 6F 61 64 65 72 73 2E 0D     Basic loaders..
003F40:  0A 20 20 20 20 46 69 6C 65 20 20 27 4D 4F 52 45    .    File  'MORE
003F50:  2D 43 48 41 52 2E 44 41 54 27 20 69 73 20 6A 75    -CHAR.DAT' is ju
003F60:  73 74 20 61 20 20 63 75 74 20 2E 46 4E 54 20 66    st a  cut .FNT f
003F70:  69 6C 65 2C 20 20 77 68 69 63 68 20 63 6F 6E 74    ile,  which cont
003F80:  61 69 6E 73 20 20 74 65 6E 20 20 63 68 61 72 73    ains  ten  chars
003F90:  0D 0A 20 20 20 20 28 6C 65 6E 67 74 68 20 3D 20    ..    (length = 
003FA0:  38 30 20 62 79 74 65 73 29 2E 0D 0A 0D 0A 20 20    80 bytes).....  
003FB0:  20 20 59 6F 75 20 20 63 61 6E 20 61 6C 73 6F 20      You  can also 
003FC0:  20 6D 6F 64 69 66 79 20 20 77 6F 72 6B 69 6E 67     modify  working
003FD0:  20 63 68 61 72 73 65 74 20 66 69 6C 65 20 6F 66     charset file of
003FE0:  20 47 57 45 44 49 54 2C 20 63 68 61 6E 67 69 6E     GWEDIT, changin
003FF0:  67 20 74 68 65 20 64 65 66 61 75 6C 74 0D 0A 20    g the default.. 
004000:  20 20 20 66 69 6C 65 20 27 53 59 53 2D 55 4B 2E       file 'SYS-UK.
004010:  46 4E 54 27 2E 20 20 46 72 65 6E 63 68 20 75 73    FNT'.  French us
004020:  65 72 73 20 63 6F 75 6C 64 20 20 66 69 6E 64 20    ers could  find 
004030:  74 68 65 69 72 20 62 65 6C 6F 76 65 64 20 61 63    their beloved ac
004040:  63 65 6E 74 73 20 77 69 74 68 20 74 68 65 0D 0A    cents with the..
004050:  20 20 20 20 66 69 6C 65 20 53 59 53 2D 46 52 2E        file SYS-FR.
004060:  46 4E 54 2E 0D 0A 20 20 20 0D 0A 0D 0A 49 49 49    FNT...   ....III
004070:  20 47 57 4C 49 4E 4B 2C 20 74 68 65 20 69 6E 74     GWLINK, the int
004080:  72 6F 20 63 6F 6D 70 69 6C 65 72 0D 0A 0D 0A 54    ro compiler....T
004090:  68 69 73 20 70 72 6F 67 72 61 6D 20 69 73 20 75    his program is u
0040A0:  73 65 64 20 74 6F 20 6C 6F 61 64 20 61 6E 64 20    sed to load and 
0040B0:  76 65 72 69 66 79 20 64 61 74 61 66 69 6C 65 73    verify datafiles
0040C0:  20 74 6F 20 63 6F 6D 70 6F 73 65 20 61 6E 20 69     to compose an i
0040D0:  6E 74 72 6F 64 75 63 74 69 6F 6E 2C 0D 0A 64 65    ntroduction,..de
0040E0:  66 69 6E 65 20 69 74 73 20 63 6F 6C 6F 72 73 20    fine its colors 
0040F0:  61 6E 64 20 73 61 76 65 20 61 20 73 65 6C 66 2D    and save a self-
004100:  6E 63 68 65 64 20 77 69 74 68 20 61 20 42 61 73    nched with a Bas
004110:  69 63 20 6C 6F 61 64 65 72 2C 20 73 6F 0D 0A 20    ic loader, so.. 
004120:  20 20 69 74 20 69 73 20 72 65 61 6C 6C 79 20 65      it is really e
004130:  61 73 79 20 74 6F 20 75 73 65 20 69 74 20 69 6E    asy to use it in
004140:  20 61 20 64 69 73 6B 20 66 61 6E 7A 69 6E 65 2E     a disk fanzine.
004150:  0D 0A 20 20 0D 0A 20 20 20 47 57 4C 49 4E 4B 20    ..  ..   GWLINK 
004160:  6E 65 65 64 73 20 31 38 20 74 6F 20 33 36 20 6B    needs 18 to 36 k
004170:  6F 20 74 6F 20 73 61 76 65 20 61 6E 20 20 20 69    o to save an   i
004180:  6E 74 72 6F 64 75 63 74 69 6F 6E 20 6F 6E 20 61    ntroduction on a
004190:  20 64 69 73 6B 2E 20 20 54 6F 20 73 68 6F 72 74     disk.  To short
0041A0:  65 6E 0D 0A 20 20 20 74 68 65 20 6C 65 6E 67 74    en..   the lengt
0041B0:  68 20 20 6F 66 20 61 6E 20 69 6E 74 72 6F 2C 20    h  of an intro, 
0041C0:  20 79 6F 75 20 63 61 6E 20 63 72 75 6E 63 68 20     you can crunch 
0041D0:  69 74 20 20 77 69 74 68 20 20 6F 6E 65 20 6F 66    it  with  one of
0041E0:  20 74 68 65 73 65 20 65 78 63 65 6C 6C 65 6E 74     these excellent
0041F0:  0D 0A 20 20 20 75 74 69 6C 69 74 69 65 73 20 3A    ..   utilities :
004200:  0D 0A 0D 0A 20 20 20 20 20 20 20 2A 20 43 68 65    ....       * Che
004210:  65 73 65 20 6F 66 20 41 6E 74 6F 69 6E 65 20 50    ese of Antoine P
004220:  69 74 72 6F 75 20 28 43 4F 44 21 29 20 3A 20 66    itrou (COD!) : f
004230:  61 73 74 20 61 6E 64 20 67 6F 6F 64 20 63 72 75    ast and good cru
004240:  6E 63 68 65 72 2E 20 55 6E 66 6F 72 74 75 2D 0D    ncher. Unfortu-.
004250:  0A 20 20 20 20 20 20 20 20 20 6E 61 74 65 6C 79    .         nately
004260:  2C 20 20 43 68 65 65 73 65 20 31 2E 30 20 6E 65    ,  Cheese 1.0 ne
004270:  65 64 73 20 73 6F 6D 65 20 6D 65 6D 6F 72 79 20    eds some memory 
004280:  73 70 61 63 65 20 75 73 65 64 20 62 79 20 42 61    space used by Ba
004290:  73 69 63 2E 20 53 6F 2C 20 79 6F 75 0D 0A 20 20    sic. So, you..  
0042A0:  20 20 20 20 20 20 20 79 6F 75 20 63 61 6E 27 74           you can't
0042B0:  20 73 74 61 72 74 20 61 6E 20 69 6E 74 72 6F 20     start an intro 
0042C0:  63 72 75 6E 63 68 65 64 20 20 77 69 74 68 20 74    crunched  with t
0042D0:  68 69 73 20 75 74 69 6C 69 74 79 20 20 75 6E 64    his utility  und
0042E0:  65 72 20 42 61 73 69 63 2E 0D 0A 20 20 20 20 20    er Basic...     
0042F0:  20 20 20 20 54 72 79 20 74 6F 20 66 69 6E 64 20        Try to find 
004300:  65 78 65 63 75 74 61 62 6C 65 20 69 6E 74 72 6F    executable intro
004310:  2E 0D 0A 0D 0A 31 29 20 47 57 4C 49 4E 4B 20 63    .....1) GWLINK c
004320:  6F 6D 6D 61 6E 64 73 0D 0A 0D 0A 20 20 20 20 41    ommands....    A
004330:  29 20 48 6F 77 20 74 6F 20 63 68 6F 6F 73 65 20    ) How to choose 
004340:  61 20 64 61 74 61 66 69 6C 65 20 70 61 74 74 65    a datafile patte
004350:  72 6E 0D 0A 0D 0A 20 20 20 20 20 20 20 42 79 20    rn....       By 
004360:  70 72 65 73 73 69 6E 67 20 6F 6E 65 20 6F 66 20    pressing one of 
004370:  74 68 65 20 66 6F 6C 6C 6F 77 69 6E 67 20 6B 65    the following ke
004380:  79 73 2C 20 79 6F 75 20 73 65 6C 65 63 74 20 61    ys, you select a
004390:  20 70 61 74 74 65 72 6E 20 6F 66 20 64 61 74 61     pattern of data
0043A0:  66 69 6C 65 2E 0D 0A 20 20 20 20 20 20 20 54 68    file...       Th
0043B0:  75 73 2C 20 63 6F 6D 6D 61 6E 64 73 20 20 28 44    us, commands  (D
0043C0:  29 69 72 20 61 6E 64 20 28 4F 29 70 65 6E 20 20    )ir and (O)pen  
0043D0:  63 6F 6E 73 69 64 65 72 20 74 68 69 73 20 6B 69    consider this ki
0043E0:  6E 64 20 6F 66 20 66 69 6C 65 20 20 61 73 20 64    nd of file  as d
0043F0:  65 66 61 75 6C 74 0D 0A 20 20 20 20 20 20 20 66    efault..       f
004400:  69 6C 65 20 74 79 70 65 2E 0D 0A 20 20 20 20 20    ile type...     
004410:  20 20 0D 0A 20 20 20 20 20 20 20 20 20 20 28 54      ..          (T
004420:  29 65 78 74 20 66 69 6C 65 20 20 20 3A 20 43 6F    )ext file   : Co
004430:  6D 70 72 65 73 73 65 64 20 74 65 78 74 0D 0A 20    mpressed text.. 
004440:  20 20 20 20 20 20 20 20 20 28 46 29 6F 6E 74 20             (F)ont 
004450:  66 69 6C 65 20 20 20 3A 20 2E 2E 2E 0D 0A 20 20    file   : .....  
004460:  20 20 20 20 20 20 20 20 28 4C 29 6F 67 6F 20 66            (L)ogo f
004470:  69 6C 65 20 20 20 3A 20 2E 2E 2E 0D 0A 20 20 20    ile   : .....   
004480:  20 20 20 20 20 20 20 28 4D 29 75 73 69 63 20 66           (M)usic f
004490:  69 6C 65 20 20 3A 20 2E 2E 2E 0D 0A 20 20 20 20    ile  : .....    
0044A0:  20 20 20 20 20 20 28 31 29 73 74 20 46 78 20 66          (1)st Fx f
0044B0:  69 6C 65 20 3A 20 63 6C 65 61 72 73 63 72 65 65    ile : clearscree
0044C0:  6E 20 6D 65 74 68 6F 64 0D 0A 20 20 20 20 20 20    n method..      
0044D0:  20 20 20 20 28 32 29 6E 64 20 66 78 20 66 69 6C        (2)nd fx fil
0044E0:  65 20 3A 20 61 6E 69 6D 61 74 69 6F 6E 20 66 69    e : animation fi
0044F0:  6C 65 0D 0A 0D 0A 20 20 20 42 29 20 6D 61 69 6E    le....   B) main
004500:  74 68 65 20 31 2E 31 20 72 65 6C 65 61 73 65 20    the 1.1 release 
004510:  77 68 69 63 68 20 69 73 20 70 65 72 66 65 63 74    which is perfect
004520:  20 66 6F 72 20 47 2E 57 20 21 20 0D 0A 0D 0A 20     for G.W ! .... 
004530:  20 20 20 20 20 20 2A 20 43 72 75 6E 63 68 65 72          * Cruncher
004540:  20 6F 66 20 43 72 6F 77 6E 20 28 42 45 4E 47 21     of Crown (BENG!
004550:  29 20 3A 20 20 53 4C 4F 57 20 62 75 74 20 67 72    ) :  SLOW but gr
004560:  65 61 74 20 70 72 6F 67 72 61 6D 20 21 20 49 6E    eat program ! In
004570:  74 72 6F 73 20 63 72 75 6E 2D 0D 0A 20 20 20 20    tros crun-..    
004580:  20 20 20 20 20 63 68 65 64 20 77 69 74 68 20 43         ched with C
004590:  72 75 6E 63 68 65 72 20 63 61 6E 20 62 65 20 6C    runcher can be l
0045A0:  6F 61 64 65 64 20 75 6E 64 65 72 20 42 61 73 69    oaded under Basi
0045B0:  63 20 77 69 74 68 6F 75 74 20 61 6E 79 20 70 72    c without any pr
0045C0:  6F 62 6C 65 6D 2E 20 0D 0A 0D 0A 20 20 20 59 6F    oblem. ....   Yo
0045D0:  75 20 77 69 6C 6C 20 6F 62 74 61 69 6E 20 61 20    u will obtain a 
0045E0:  6E 65 77 20 66 69 6C 65 20 77 68 6F 73 65 20 6C    new file whose l
0045F0:  65 6E 67 74 68 20 77 69 6C 6C 20 62 65 20 62 65    ength will be be
004600:  74 77 65 65 6E 20 38 20 61 6E 64 20 31 32 20 6B    tween 8 and 12 k
004610:  6F 2E 0D 0A 20 20 0D 0A 20 20 20 49 66 20 79 6F    o...  ..   If yo
004620:  75 20 20 72 65 61 6C 6C 79 20 77 61 6E 74 20 74    u  really want t
004630:  6F 20 73 61 76 65 20 20 73 70 61 63 65 20 6F 6E    o save  space on
004640:  20 64 69 73 6B 2C 20 20 79 6F 75 20 20 63 61 6E     disk,  you  can
004650:  20 73 68 6F 72 74 65 6E 20 20 61 6E 20 20 69 6E     shorten  an  in
004660:  74 72 6F 0D 0A 20 20 20 6C 65 6E 67 74 68 2E 20    tro..   length. 
004670:  20 4A 75 73 74 20 64 6F 6E 27 74 20 75 73 65 20     Just don't use 
004680:  61 20 6D 75 73 69 63 2C 20 20 61 20 6C 6F 67 6F    a music,  a logo
004690:  20 6F 72 20 61 6E 20 61 6E 69 6D 61 74 69 6F 6E     or an animation
0046A0:  20 69 6E 20 79 6F 75 72 20 69 6E 74 72 6F 20 21     in your intro !
0046B0:  0D 0A 20 20 20 54 6F 20 64 6F 20 73 75 63 68 20    ..   To do such 
0046C0:  61 20 74 68 69 6E 67 2C 20 70 75 74 20 6F 6E 65    a thing, put one
0046D0:  20 6F 66 20 74 68 65 20 66 6F 6C 6C 6F 77 69 6E     of the followin
0046E0:  67 20 66 69 6C 65 73 20 69 6E 20 6D 65 6D 6F 72    g files in memor
0046F0:  79 2E 0D 0A 0D 0A 20 20 20 20 20 20 20 20 20 20    y.....          
004700:  20 63 6F 6D 6D 61 6E 64 73 0D 0A 0D 0A 20 20 20     commands....   
004710:  20 20 20 28 44 29 69 72 20 20 20 20 20 20 20 20       (D)ir        
004720:  20 3A 20 64 69 73 6B 65 74 74 65 20 64 69 72 65     : diskette dire
004730:  63 74 6F 72 79 2E 0D 0A 20 20 20 20 20 20 28 4F    ctory...      (O
004740:  29 70 65 6E 20 66 69 6C 65 20 20 20 3A 20 6C 6F    )pen file   : lo
004750:  61 64 20 61 20 64 61 74 61 66 69 6C 65 2E 20 42    ad a datafile. B
004760:  65 66 6F 72 65 20 70 75 74 74 69 6E 67 20 69 74    efore putting it
004770:  20 69 6E 20 6D 65 6D 6F 72 79 2C 20 73 6F 6D 65     in memory, some
004780:  20 74 65 73 74 73 0D 0A 20 20 20 20 20 20 20 20     tests..        
004790:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 61 72                  ar
0047A0:  65 20 64 6F 6E 65 20 74 6F 20 63 6F 6E 74 72 6F    e done to contro
0047B0:  6C 20 66 69 6C 65 20 73 74 72 75 63 74 75 72 65    l file structure
0047C0:  20 28 6C 6F 61 64 69 6E 67 20 61 64 64 72 65 73     (loading addres
0047D0:  73 2C 0D 0A 20 20 20 20 20 20 20 20 20 20 20 20    s,..            
0047E0:  20 20 20 20 20 20 20 20 20 20 6C 65 6E 67 74 68              length
0047F0:  2C 20 45 6E 74 72 79 29 0D 0A 20 20 20 20 20 20    , Entry)..      
004800:  28 53 29 61 76 65 20 69 6E 74 72 6F 20 20 3A 20    (S)ave intro  : 
004810:  73 61 76 65 20 69 6E 74 72 6F 64 75 63 74 69 6F    save introductio
004820:  6E 20 28 61 6C 6C 20 64 61 74 61 66 69 6C 65 20    n (all datafile 
004830:  6D 75 73 74 20 68 61 76 65 20 62 65 65 6E 20 70    must have been p
004840:  75 74 20 69 6E 0D 0A 20 20 20 20 20 20 20 20 20    ut in..         
004850:  20 20 20 20 20 20 20 20 20 20 20 20 20 6D 65 6D                 mem
004860:  6F 72 79 29 2E 0D 0A 20 20 20 20 20 20 28 43 29    ory)...      (C)
004870:  6F 6E 66 69 67 20 20 20 20 20 20 3A 20 63 6F 6E    onfig      : con
004880:  66 69 67 75 72 65 20 69 6E 74 72 6F 64 75 63 74    figure introduct
004890:  69 6F 6E 2E 20 28 55 50 29 20 61 6E 64 20 28 44    ion. (UP) and (D
0048A0:  4F 57 4E 29 20 61 72 72 6F 77 73 20 74 6F 20 20    OWN) arrows to  
0048B0:  63 68 6F 6F 2D 0D 0A 20 20 20 20 20 20 20 20 20    choo-..         
0048C0:  20 20 20 20 20 20 20 20 20 20 20 20 20 73 65 20                 se 
0048D0:  61 20 70 61 72 61 6D 65 74 65 72 20 6C 69 6E 65    a parameter line
0048E0:  2C 20 28 4C 45 46 54 29 20 61 6E 64 20 28 52 49    , (LEFT) and (RI
0048F0:  47 48 54 29 20 61 72 72 6F 77 73 20 74 6F 20 63    GHT) arrows to c
004900:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 4E                   N
004910:  4F 2D 4D 55 53 49 43 2E 4D 55 53 0D 0A 20 20 20    O-MUSIC.MUS..   
004920:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
004930:  20 20 20 20 20 20 4E 4F 2D 4C 4F 47 4F 20 2E 47          NO-LOGO .G
004940:  57 4C 0D 0A 20 20 20 20 20 20 20 20 20 20 20 20    WL..            
004950:  20 20 20 20 20 20 20 20 20 20 20 20 20 4E 4F 2D                 NO-
004960:  46 58 32 20 20 2E 47 57 58 0D 0A 0D 0A 0D 0A 49    FX2  .GWX......I
004970:  56 20 47 57 4C 4F 47 4F 2C 20 74 68 65 20 4C 6F    V GWLOGO, the Lo
004980:  67 6F 20 6D 61 6B 65 72 0D 0A 0D 0A 54 68 69 73    go maker....This
004990:  20 70 72 6F 67 72 61 6D 2C 20 77 72 69 74 74 65     program, writte
0049A0:  6E 20 69 6E 20 42 61 73 69 63 2C 20 69 73 20 72    n in Basic, is r
0049B0:  65 61 6C 6C 79 20 65 61 73 79 20 74 6F 20 75 73    eally easy to us
0049C0:  65 2E 20 57 69 74 68 20 61 20 20 31 37 6B 6F 20    e. With a  17ko 
0049D0:  73 74 61 6E 64 61 72 64 0D 0A 73 63 72 65 65 6E    standard..screen
0049E0:  2C 20 69 74 20 61 6C 6C 6F 77 73 20 79 6F 75 20    , it allows you 
0049F0:  74 6F 20 63 72 65 61 74 65 20 61 20 6C 6F 67 6F    to create a logo
004A00:  20 66 69 6C 65 20 28 2E 47 57 4C 20 65 78 74 65     file (.GWL exte
004A10:  6E 73 69 6F 6E 29 2E 20 20 59 6F 75 20 6A 75 73    nsion).  You jus
004A20:  74 20 68 61 76 65 0D 0A 74 6F 20 67 69 76 65 20    t have..to give 
004A30:  74 68 65 20 6E 61 6D 65 20 6F 66 20 74 68 65 20    the name of the 
004A40:  70 69 63 74 75 72 65 20 61 6E 64 20 74 68 65 20    picture and the 
004A50:  6E 61 6D 65 20 20 6F 66 20 74 68 65 20 6C 6F 67    name  of the log
004A60:  6F 20 66 69 6C 65 20 21 20 20 4F 66 20 63 6F 75    o file !  Of cou
004A70:  72 73 65 2C 0D 0A 79 6F 75 72 20 66 75 74 75 72    rse,..your futur
004A80:  65 20 6C 6F 67 6F 20 6D 75 73 74 20 62 65 20 6F    e logo must be o
004A90:  6E 20 61 20 20 70 61 72 74 69 63 75 6C 61 72 20    n a  particular 
004AA0:  70 6C 61 63 65 20 3A 20 20 69 6E 20 74 68 65 20    place :  in the 
004AB0:  6C 65 66 74 20 68 61 6E 64 20 74 6F 70 20 63 6F    left hand top co
004AC0:  72 2D 0D 0A 6F 66 20 74 68 65 20 73 74 61 6E 64    r-..of the stand
004AD0:  61 72 64 20 73 63 72 65 65 6E 2C 20 61 6E 64 20    ard screen, and 
004AE0:  63 65 6E 74 65 72 65 64 20 6F 6E 20 74 68 65 20    centered on the 
004AF0:  66 6F 6C 6C 6F 77 69 6E 67 20 68 65 69 67 68 74    following height
004B00:  68 61 6E 67 65 0D 0A 20 20 20 20 20 20 20 20 20    hange..         
004B10:  20 20 20 20 20 20 20 20 20 20 20 20 20 69 74 73                 its
004B20:  20 76 61 6C 75 65 2E 20 54 6F 20 63 6F 6D 65 20     value. To come 
004B30:  62 61 63 6B 20 74 6F 20 74 68 65 20 6D 61 69 6E    back to the main
004B40:  20 6D 65 6E 75 2C 20 70 72 65 73 73 20 28 45 53     menu, press (ES
004B50:  43 29 2E 0D 0A 20 20 20 20 20 20 28 56 29 69 65    C)...      (V)ie
004B60:  77 20 69 6E 74 72 6F 20 20 3A 20 64 69 73 70 6C    w intro  : displ
004B70:  61 79 20 6C 6F 61 64 65 64 20 64 61 74 61 66 69    ay loaded datafi
004B80:  6C 65 20 20 6E 61 6D 65 73 20 61 6E 64 20 72 75    le  names and ru
004B90:  6E 20 74 68 65 20 69 6E 74 72 6F 64 75 63 74 69    n the introducti
004BA0:  6F 6E 2E 0D 0A 20 20 20 20 20 20 20 20 20 20 20    on...           
004BB0:  20 20 20 20 20 20 20 20 20 20 20 49 66 20 20 61               If  a
004BC0:  20 20 70 61 72 61 6D 65 74 65 72 20 66 69 6C 65      parameter file
004BD0:  20 20 69 73 20 20 6D 69 73 73 69 6E 67 2C 20 74      is  missing, t
004BE0:  68 65 20 20 69 6E 74 72 6F 20 20 77 69 6C 6C 20    he  intro  will 
004BF0:  6E 6F 74 20 0D 0A 20 20 20 20 20 20 20 20 20 20    not ..          
004C00:  20 20 20 20 20 20 20 20 20 20 20 20 73 74 61 72                star
004C10:  74 2E 20 4E 6F 74 65 20 74 68 61 74 20 66 6F 72    t. Note that for
004C20:  20 61 6E 20 69 6E 74 72 6F 20 77 69 74 68 20 74     an intro with t
004C30:  65 78 74 20 69 6E 20 6D 6F 64 65 20 74 77 6F 2C    ext in mode two,
004C40:  20 79 6F 75 0D 0A 20 20 20 20 20 20 20 20 20 20     you..          
004C50:  20 20 20 20 20 20 20 20 20 20 20 20 79 6F 75 20                you 
004C60:  64 6F 6E 27 74 20 68 61 76 65 20 74 6F 20 6C 6F    don't have to lo
004C70:  61 64 20 61 6E 20 61 6E 69 6D 61 74 69 6F 6E 20    ad an animation 
004C80:  64 61 74 61 66 69 6C 65 2E 0D 0A 20 20 20 20 20    datafile...     
004C90:  20 28 41 29 3A 20 20 20 20 20 20 20 20 20 20 3A     (A):          :
004CA0:  20 64 72 69 76 65 20 41 3A 20 69 73 20 61 63 74     drive A: is act
004CB0:  69 76 65 0D 0A 20 20 20 20 20 20 28 42 29 3A 20    ive..      (B): 
004CC0:  20 20 20 20 20 20 20 20 20 3A 20 64 72 69 76 65             : drive
004CD0:  20 42 3A 20 69 73 20 61 63 74 69 76 65 0D 0A 0D     B: is active...
004CE0:  0A 0D 0A 32 29 20 47 57 4C 49 4E 4B 20 74 69 70    ...2) GWLINK tip
004CF0:  73 20 26 20 74 72 69 63 6B 73 0D 0A 0D 0A 20 20    s & tricks....  
004D00:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
004D10:  04 00 01 00 02 09 4E E5 04 00 C1 02 00 00 00 02    ......N.........
004D20:  04 00 C6 02 00 00 00 02 04 00 C2 02 00 00 00 02    ................
004D30:  04 00 C7 02 00 00 00 02 04 00 C3 02 00 00 00 02    ................
004D40:  04 00 C8 02 00 00 00 02 04 00 C4 02 00 00 00 02    ................
004D50:  04 00 C9 02 00 00 00 02 04 00 C5 02 00 00 00 02    ................
004D60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
004D70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
004D80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
004D90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
004DA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
004DB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
004DC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
004DD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
004DE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
004DF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
004E00:  20 61 6E 64 20 77 69 64 74 68 20 3A 0D 0A 0D 0A     and width :....
004E10:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
004E20:  2D 20 48 65 69 67 68 74 20 20 20 3A 20 36 20 63    - Height   : 6 c
004E30:  68 61 72 73 20 20 28 20 3D 20 34 38 20 76 69 64    hars  ( = 48 vid
004E40:  65 6F 20 6C 69 6E 65 73 29 0D 0A 20 20 20 20 20    eo lines)..     
004E50:  20 20 20 20 20 20 20 20 20 20 20 2D 20 57 69 64               - Wid
004E60:  74 68 20 20 20 20 3A 20 33 37 20 63 68 61 72 73    th    : 37 chars
004E70:  20 28 20 3D 20 37 34 20 62 79 74 65 73 29 0D 0A     ( = 74 bytes)..
004E80:  0D 0A 44 6F 6E 27 74 20 70 61 6E 69 63 20 20 21    ..Don't panic  !
004E90:  20 20 49 20 68 61 76 65 20 6D 61 64 65 20 61 6E      I have made an
004EA0:  6F 74 68 65 72 20 20 6C 69 74 74 6C 65 20 70 72    other  little pr
004EB0:  6F 67 72 61 6D 20 77 68 69 63 68 20 64 72 61 77    ogram which draw
004EC0:  73 20 61 20 66 72 61 6D 65 20 69 6E 20 61 0D 0A    s a frame in a..
004ED0:  70 69 63 74 75 72 65 20 61 6E 64 20 73 61 76 65    picture and save
004EE0:  73 20 69 74 20 61 73 20 61 20 73 74 61 6E 64 61    s it as a standa
004EF0:  72 64 20 73 63 72 65 65 6E 20 66 69 6C 65 2E 20    rd screen file. 
004F00:  54 68 65 20 61 72 65 61 20 69 6E 73 69 64 65 20    The area inside 
004F10:  74 68 65 20 66 72 61 6D 65 20 69 73 0D 0A 74 68    the frame is..th
004F20:  65 20 73 69 7A 65 20 6F 66 20 61 20 6C 6F 67 6F    e size of a logo
004F30:  2E 20 54 68 69 73 20 6D 61 67 69 63 61 6C 20 70    . This magical p
004F40:  72 6F 67 72 61 6D 20 69 73 20 6E 61 6D 65 64 20    rogram is named 
004F50:  2D 47 57 46 52 41 4D 45 2E 42 41 53 20 21 0D 0A    -GWFRAME.BAS !..
004F60:  0D 0A 49 66 20 79 6F 75 20 61 72 65 20 6E 6F 74    ..If you are not
004F70:  20 20 61 20 67 72 65 61 74 20 67 72 61 70 68 69      a great graphi
004F80:  73 74 2C 20 20 79 6F 75 20 63 61 6E 20 68 6F 77    st,  you can how
004F90:  65 76 65 72 20 6D 61 6B 65 20 20 66 75 6E 6E 79    ever make  funny
004FA0:  20 6C 6F 67 6F 73 2E 20 20 47 2E 57 2E 0D 0A 69     logos.  G.W...i
004FB0:  6E 63 6C 75 64 65 73 20 61 20 6C 69 74 74 6C 65    ncludes a little
004FC0:  20 20 63 6C 69 70 61 72 74 20 20 6C 69 62 72 61      clipart  libra
004FD0:  72 79 2E 20 20 4C 6F 61 64 20 74 68 65 20 20 66    ry.  Load the  f
004FE0:  69 6C 65 20 47 57 2D 43 4C 49 50 2E 53 43 52 20    ile GW-CLIP.SCR 
004FF0:  20 77 69 74 68 20 79 6F 75 72 0D 0A 62 65 73 74     with your..best
005000:  0A 20 20 20 20 20 20 20 20 20 20 20 54 68 61 74    .           That
005010:  20 66 69 6C 65 20 69 73 20 6D 61 64 65 20 6F 66     file is made of
005020:  20 31 34 35 20 62 79 74 65 73 2E 20 45 61 63 68     145 bytes. Each
005030:  20 62 79 74 65 20 72 65 70 72 65 73 65 6E 74 73     byte represents
005040:  20 6F 6E 65 20 6F 66 20 74 68 65 0D 0A 20 20 20     one of the..   
005050:  20 20 20 20 20 20 20 20 31 34 35 20 6C 69 6E 65            145 line
005060:  73 20 20 6F 66 20 20 74 68 65 20 74 65 78 74 20    s  of  the text 
005070:  73 63 72 65 65 6E 20 74 6F 20 64 65 6C 65 74 65    screen to delete
005080:  2E 20 20 4C 61 73 74 20 62 79 74 65 20 69 73 20    .  Last byte is 
005090:  20 61 6E 20 65 6E 64 0D 0A 20 20 20 20 20 20 20     an end..       
0050A0:  20 20 20 20 63 6F 6E 74 72 6F 6C 20 63 6F 64 65        control code
0050B0:  2E 20 49 74 73 20 76 61 6C 75 65 20 69 73 20 61    . Its value is a
0050C0:  6C 77 61 79 73 20 32 35 35 20 28 26 46 46 20 69    lways 255 (&FF i
0050D0:  6E 20 68 65 78 61 29 2E 0D 0A 0D 0A 20 20 20 20    n hexa).....    
0050E0:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
0050F0:  2A 20 2E 47 57 45 20 66 69 6C 65 20 6C 65 6E 67    * .GWE file leng
005100:  74 68 20 20 3A 20 26 30 30 39 31 0D 0A 0D 0A 2E    th  : &0091.....
005110:  47 57 58 20 66 69 6C 65 20 3A 20 61 6E 69 6D 61    GWX file : anima
005120:  74 69 6F 6E 0D 0A 0D 0A 20 20 20 20 20 20 20 20    tion....        
005130:  20 20 20 41 20 2E 47 57 58 20 66 69 6C 65 20 69       A .GWX file i
005140:  73 20 6A 75 73 74 20 61 20 6C 69 74 74 6C 65 20    s just a little 
005150:  72 6F 75 74 69 6E 65 20 64 6F 69 6E 67 20 61 20    routine doing a 
005160:  67 72 61 70 68 69 63 61 6C 20 65 66 66 65 63 74    graphical effect
005170:  0D 0A 20 20 20 20 20 20 20 20 20 20 20 62 65 68    ..           beh
005180:  69 6E 64 20 74 68 65 20 74 65 78 74 20 28 6F 6E    ind the text (on
005190:  6C 79 20 66 6F 72 20 61 20 6D 6F 64 65 20 31 20    ly for a mode 1 
0051A0:  6D 65 73 73 61 67 65 29 2E 0D 0A 0D 0A 20 20 20    message).....   
0051B0:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
0051C0:  20 20 20 20 2A 20 6C 6F 61 64 69 6E 67 20 61 64        * loading ad
0051D0:  64 72 65 73 73 20 20 20 20 20 20 20 20 3A 20 26    dress        : &
0051E0:  39 36 30 30 0D 0A 20 20 20 20 20 20 20 20 20 20    9600..          
0051F0:  20 20 20 20 20 20 20 20 20 20 20 20 20 2A 20 69                 * i
005200:  20 70 61 69 6E 74 69 6E 67 20 70 72 6F 67 72 61     painting progra
005210:  6D 20 61 6E 64 20 6D 61 6B 65 20 79 6F 75 72 20    m and make your 
005220:  63 68 6F 69 63 65 20 21 0D 0A 0D 0A 0D 0A 56 20    choice !......V 
005230:  47 57 46 4F 4E 54 2C 20 42 61 73 69 63 20 63 68    GWFONT, Basic ch
005240:  61 72 73 65 74 20 74 6F 20 2E 46 4E 54 20 66 69    arset to .FNT fi
005250:  6C 65 20 6D 61 6B 65 72 0D 0A 0D 0A 54 68 69 73    le maker....This
005260:  20 70 72 6F 67 72 61 6D 20 63 6F 6E 63 65 72 6E     program concern
005270:  73 20 6F 6E 6C 79 20 70 65 6F 70 6C 65 20 77 68    s only people wh
005280:  6F 20 64 65 73 69 67 6E 20 63 68 61 72 73 65 74    o design charset
005290:  73 20 75 6E 64 65 72 20 42 61 73 69 63 20 77 69    s under Basic wi
0052A0:  74 68 20 74 68 65 0D 0A 53 59 4D 42 4F 4C 20 63    th the..SYMBOL c
0052B0:  6F 6D 6D 61 6E 64 2E 20 20 4F 77 69 6E 67 20 74    ommand.  Owing t
0052C0:  6F 20 47 57 46 4F 4E 54 2C 20 20 77 65 20 63 61    o GWFONT,  we ca
0052D0:  6E 20 63 6F 6E 76 65 72 74 20 74 68 65 73 65 20    n convert these 
0052E0:  20 63 68 61 72 73 65 74 73 20 20 69 6E 20 2E 46     charsets  in .F
0052F0:  4E 54 0D 0A 64 61 74 61 66 69 6C 65 73 20 21 20    NT..datafiles ! 
005300:  41 6E 6F 74 68 65 72 20 66 72 69 65 6E 64 6C 79    Another friendly
005310:  20 70 72 6F 67 72 61 6D 20 3A 20 6A 75 73 74 20     program : just 
005320:  70 75 74 20 79 6F 75 72 20 63 68 61 72 73 65 74    put your charset
005330:  20 69 6E 20 6D 65 6D 6F 72 79 20 61 6E 64 0D 0A     in memory and..
005340:  73 74 61 72 74 20 2D 47 57 46 4F 4E 54 2E 42 41    start -GWFONT.BA
005350:  53 20 21 0D 0A 0D 0A 0D 0A 55 49 20 47 57 2D 53    S !......UI GW-S
005360:  54 2C 20 53 6F 75 6E 64 74 72 61 6B 6B 65 72 27    T, Soundtrakker'
005370:  73 20 63 6F 6D 70 69 6C 65 64 20 6D 75 73 69 63    s compiled music
005380:  73 20 72 65 6C 6F 63 61 74 6F 72 0D 0A 0D 0A 47    s relocator....G
005390:  57 2D 53 54 20 69 73 20 6F 6E 65 20 6F 66 20 74    W-ST is one of t
0053A0:  68 65 20 6D 6F 72 65 20 20 70 72 61 63 74 69 63    he more  practic
0053B0:  61 6C 20 70 72 6F 67 72 61 6D 20 6F 66 20 47 2E    al program of G.
0053C0:  57 2E 20 20 54 68 61 6E 6B 73 20 74 6F 20 69 74    W.  Thanks to it
0053D0:  2C 20 79 6F 75 20 63 61 6E 0D 0A 63 68 61 6E 67    , you can..chang
0053E0:  65 20 74 68 65 20 6C 6F 61 64 69 6E 67 20 61 6E    e the loading an
0053F0:  64 20 65 6E 74 72 79 20 61 64 64 72 65 73 73 65    d entry addresse
005400:  6E 69 74 20 61 64 64 72 65 73 73 20 20 20 20 20    nit address     
005410:  20 20 20 20 20 20 3A 20 26 39 36 30 30 0D 0A 20          : &9600.. 
005420:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
005430:  20 20 20 20 20 20 2A 20 65 78 65 63 20 61 64 64          * exec add
005440:  72 65 73 73 20 20 20 20 20 20 20 20 20 20 20 3A    ress           :
005450:  20 26 39 36 30 33 0D 0A 20 20 20 20 20 20 20 20     &9603..        
005460:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 2A                   *
005470:  20 65 6E 64 20 61 64 64 72 65 73 73 20 20 20 20     end address    
005480:  20 20 20 20 20 20 20 20 3A 20 26 39 36 30 36 0D            : &9606.
005490:  0A 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20    .               
0054A0:  20 20 20 20 20 20 20 20 2A 20 6D 61 78 69 6D 75            * maximu
0054B0:  6D 20 6C 65 6E 67 74 68 20 20 20 20 20 20 20 20    m length        
0054C0:  20 3A 20 26 30 41 30 30 0D 0A 0D 0A 20 20 20 20     : &0A00....    
0054D0:  20 20 20 20 20 20 20 54 68 65 20 72 6F 75 74 69           The routi
0054E0:  6E 65 20 6D 75 73 74 20 6E 6F 74 20 62 65 20 74    ne must not be t
0054F0:  6F 6F 20 73 6C 6F 77 20 28 6D 61 78 69 6D 75 6D    oo slow (maximum
005500:  2C 20 31 20 48 41 4C 54 29 2E 20 4F 6E 6C 79 20    , 1 HALT). Only 
005510:  6F 6E 65 20 69 6E 6B 0D 0A 20 20 20 20 20 20 20    one ink..       
005520:  20 20 20 20 69 73 20 61 76 61 69 6C 61 62 6C 65        is available
005530:  2C 20 74 6F 20 70 72 65 73 65 72 76 65 20 74 65    , to preserve te
005540:  78 74 20 63 68 61 72 73 20 28 69 6E 6B 20 32 2C    xt chars (ink 2,
005550:  20 62 69 74 73 20 37 2C 36 2C 35 2C 34 29 2E 0D     bits 7,6,5,4)..
005560:  0A 20 20 20 20 20 20 20 20 20 20 20 0D 0A 20 20    .           ..  
005570:  20 20 20 20 20 20 20 20 20 54 68 65 20 74 65 78             The tex
005580:  74 73 63 72 65 65 6E 20 69 73 20 6C 6F 63 61 74    tscreen is locat
005590:  65 64 20 62 65 74 77 65 65 6E 20 26 43 32 30 36    ed between &C206
0055A0:  20 61 6E 64 20 26 46 43 39 46 2E 20 54 68 65 72     and &FC9F. Ther
0055B0:  65 20 61 72 65 20 31 34 34 0D 0A 20 20 20 20 20    e are 144..     
0055C0:  20 20 20 20 20 20 6C 69 6E 65 73 20 6F 66 20 37          lines of 7
0055D0:  36 20 62 79 74 65 73 2E 0D 0A 20 20 20 20 20 20    6 bytes...      
0055E0:  20 20 20 20 20 0D 0A 20 20 20 20 20 20 20 20 20         ..         
0055F0:  20 20 54 68 65 20 69 6E 69 74 20 61 64 72 65 73      The init adres
005600:  73 20 6F 66 20 61 20 53 6F 75 6E 64 74 72 61 6B    s of a Soundtrak
005610:  6B 65 72 27 73 20 63 6F 6D 70 69 6C 65 64 20 6D    ker's compiled m
005620:  75 73 69 63 2E 0D 0A 53 6F 2C 20 69 6E 20 47 68    usic...So, in Gh
005630:  6F 75 6C 27 73 20 57 72 69 74 65 72 2C 20 79 6F    oul's Writer, yo
005640:  75 20 63 61 6E 20 75 73 65 20 6D 75 73 69 63 73    u can use musics
005650:  20 63 6F 6D 69 6E 67 20 66 72 6F 6D 20 6D 61 6E     coming from man
005660:  79 20 64 65 6D 6F 73 20 20 6F 72 20 6D 75 73 69    y demos  or musi
005670:  63 0D 0A 63 6F 6D 70 69 6C 61 74 69 6F 6E 73 2E    c..compilations.
005680:  0D 0A 0D 0A 50 6C 65 61 73 65 20 6E 6F 74 65 20    ....Please note 
005690:  74 68 61 74 20 47 57 2D 53 54 20 64 6F 65 6E 73    that GW-ST doens
0056A0:  27 74 20 77 6F 72 6B 20 77 69 74 68 20 53 54 2D    't work with ST-
0056B0:  31 32 38 20 20 6D 75 73 69 63 20 70 6C 61 79 65    128  music playe
0056C0:  72 2E 20 49 20 68 61 76 65 20 66 6F 75 6E 64 0D    r. I have found.
0056D0:  0A 74 68 69 73 20 6E 65 77 20 28 3F 29 20 53 6F    .this new (?) So
0056E0:  75 6E 64 74 72 61 6B 6B 65 72 27 73 20 6D 75 73    undtrakker's mus
0056F0:  69 63 20 73 74 72 75 63 74 75 72 65 20 69 6E 20    ic structure in 
005700:  74 68 65 20 20 6C 61 73 74 20 6D 75 73 69 63 73    the  last musics
005710:  20 63 6F 6D 70 6F 73 65 64 20 62 79 0D 0A 74 68     composed by..th
005720:  65 20 66 61 6D 6F 75 73 20 4B 61 6E 67 61 72 6F    e famous Kangaro
005730:  6F 20 6F 66 20 54 47 53 21 20 6F 6E 6C 79 2E 0D    o of TGS! only..
005740:  0A 0D 0A 57 61 72 6E 69 6E 67 20 21 20 41 73 20    ...Warning ! As 
005750:  49 20 68 61 76 65 20 63 6F 64 65 64 20 74 68 69    I have coded thi
005760:  73 20 70 72 6F 67 72 61 6D 20 77 69 74 68 6F 75    s program withou
005770:  74 20 61 6E 79 20 64 6F 63 75 6D 65 6E 74 61 74    t any documentat
005780:  69 6F 6E 20 61 62 6F 75 74 20 53 2E 54 2E 0D 0A    ion about S.T...
005790:  6D 75 73 69 63 20 73 74 72 75 63 74 75 72 65 2C    music structure,
0057A0:  20 73 6F 6D 65 20 74 75 6E 65 73 20 6D 69 67 68     some tunes migh
0057B0:  74 20 6E 6F 74 20 77 6F 72 6B 20 77 69 74 68 20    t not work with 
0057C0:  47 57 2D 53 54 2E 20 49 20 68 61 76 65 20 6D 61    GW-ST. I have ma
0057D0:  64 65 20 74 65 73 74 73 20 6F 6E 0D 0A 73 6F 6D    de tests on..som
0057E0:  65 20 6D 75 73 69 63 20 66 72 6F 6D 20 64 65 6D    e music from dem
0057F0:  6F 73 2C 20 69 74 27 73 20 6F 6B 2E 20 57 61 69    os, it's ok. Wai
005800:  73 20 69 73 20 75 73 65 66 75 6C 20 77 68 65 6E    s is useful when
005810:  2C 20 66 6F 72 20 65 78 61 6D 70 6C 65 2C 20 20    , for example,  
005820:  79 6F 75 20 77 61 6E 74 20 74 6F 20 63 72 65 61    you want to crea
005830:  74 65 0D 0A 20 20 20 20 20 20 20 20 20 20 20 61    te..           a
005840:  20 63 6F 2D 6F 72 64 69 6E 61 74 65 73 20 74 61     co-ordinates ta
005850:  62 6C 65 20 66 6F 72 20 61 20 73 74 61 72 66 69    ble for a starfi
005860:  65 6C 64 20 69 6E 20 6D 65 6D 6F 72 79 2E 0D 0A    eld in memory...
005870:  0D 0A 20 20 20 20 20 20 20 20 20 20 20 54 68 65    ..           The
005880:  20 65 6E 64 20 61 64 72 65 73 73 20 69 73 20 6F     end adress is o
005890:  6E 6C 79 20 69 6E 74 65 72 65 73 74 69 6E 67 20    nly interesting 
0058A0:  77 68 65 6E 20 79 6F 75 20 77 61 6E 74 20 74 6F    when you want to
0058B0:  20 64 69 73 70 6C 61 79 20 68 61 72 64 0D 0A 20     display hard.. 
0058C0:  20 20 20 20 20 20 20 20 20 20 73 70 72 69 74 65              sprite
0058D0:  73 20 6F 6E 20 79 6F 75 72 20 63 70 63 20 70 6C    s on your cpc pl
0058E0:  75 73 20 74 6F 20 6D 61 6B 65 20 61 6E 20 61 6E    us to make an an
0058F0:  69 6D 61 74 69 6F 6E 2E 20 46 6F 72 20 63 6F 6D    imation. For com
005900:  70 61 74 69 62 69 6C 69 74 79 0D 0A 20 20 20 20    patibility..    
005910:  20 20 20 20 20 20 20 72 65 61 73 6F 6E 73 2C 20           reasons, 
005920:  79 6F 75 20 6D 75 73 74 20 64 65 63 6C 61 72 65    you must declare
005930:  20 69 74 20 69 6E 20 65 76 65 72 79 20 72 6F 75     it in every rou
005940:  74 69 6E 65 2E 0D 0A 0D 0A 20 20 20 20 20 20 20    tine.....       
005950:  20 20 20 20 57 68 79 20 61 20 2E 47 57 45 20 6D        Why a .GWE m
005960:  61 78 69 6D 75 6D 20 6C 65 6E 67 74 68 20 69 73    aximum length is
005970:  20 26 41 30 30 20 3F 20 4A 75 73 74 20 74 6F 20     &A00 ? Just to 
005980:  73 61 76 65 20 73 70 61 63 65 20 69 6E 20 52 41    save space in RA
005990:  4D 20 66 6F 72 0D 0A 20 20 20 20 20 20 20 20 20    M for..         
0059A0:  20 20 61 20 63 72 75 6E 63 68 20 72 6F 75 74 69      a crunch routi
0059B0:  6E 65 20 61 6E 64 20 66 6F 72 20 42 61 73 69 63    ne and for Basic
0059C0:  20 64 61 74 61 73 2E 0D 0A 20 20 20 20 20 20 20     datas...       
0059D0:  20 20 20 20 20 20 20 20 20 0D 0A 0D 0A 56 49 49             ....VII
0059E0:  20 41 75 74 68 6F 72 27 73 20 77 6F 72 64 73 20     Author's words 
0059F0:  61 62 6F 75 74 20 47 68 6F 75 6C 27 73 20 57 72    about Ghoul's Wr
005A00:  74 20 61 6E 64 20 73 65 65 2E 2E 2E 0D 0A 0D 0A    t and see.......
005A10:  0D 0A 56 49 49 20 49 6E 66 6F 72 6D 61 74 69 6F    ..VII Informatio
005A20:  6E 73 20 61 62 6F 75 74 20 47 68 6F 75 6C 27 73    ns about Ghoul's
005A30:  20 57 72 69 74 65 72 20 64 61 74 61 66 69 6C 65     Writer datafile
005A40:  73 0D 0A 0D 0A 49 6E 20 74 68 69 73 20 70 61 72    s....In this par
005A50:  74 2C 20 79 6F 75 20 77 69 6C 6C 20 66 69 6E 64    t, you will find
005A60:  20 69 6E 66 6F 72 6D 61 74 69 6F 6E 73 20 61 62     informations ab
005A70:  6F 75 74 20 65 61 63 68 20 6B 69 6E 64 20 6F 66    out each kind of
005A80:  20 70 61 72 61 6D 65 74 65 72 73 20 66 69 6C 65     parameters file
005A90:  73 0D 0A 75 73 65 64 20 62 79 20 47 68 6F 75 6C    s..used by Ghoul
005AA0:  27 73 20 57 72 69 74 65 72 2E 0D 0A 0D 0A 2E 4D    's Writer......M
005AB0:  55 53 20 66 69 6C 65 20 3A 20 6D 75 73 69 63 0D    US file : music.
005AC0:  0A 20 0D 0A 20 20 20 20 20 20 20 20 20 20 20 20    . ..            
005AD0:  54 68 69 73 20 66 69 6C 65 20 68 61 64 20 74 6F    This file had to
005AE0:  20 62 65 20 63 72 65 61 74 65 64 20 77 69 74 68     be created with
005AF0:  20 74 68 65 20 42 53 43 27 73 20 53 6F 75 6E 64     the BSC's Sound
005B00:  74 72 61 6B 6B 65 72 2C 20 6F 72 20 61 6E 6F 2D    trakker, or ano-
005B10:  0D 0A 20 20 20 20 20 20 20 20 20 20 20 20 74 68    ..            th
005B20:  65 72 20 6D 75 73 69 63 20 70 72 6F 67 72 61 6D    er music program
005B30:  20 77 69 74 68 20 61 20 66 61 73 74 20 6D 75 73     with a fast mus
005B40:  69 63 20 70 6C 61 79 65 72 2E 2E 2E 0D 0A 20 20    ic player.....  
005B50:  20 20 20 20 20 20 20 20 20 20 20 0D 0A 20 20 20               ..   
005B60:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
005B70:  2A 20 6C 6F 61 64 69 6E 67 20 61 64 64 72 65 73    * loading addres
005B80:  73 20 20 3A 20 26 36 30 30 30 0D 0A 20 20 20 20    s  : &6000..    
005B90:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 2A                   *
005BA0:  20 69 6E 69 74 20 61 64 64 72 65 73 73 20 20 20     init address   
005BB0:  20 20 3A 20 26 36 30 30 30 0D 0A 20 20 20 20 20      : &6000..     
005BC0:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 2A 20                  * 
005BD0:  65 6E 74 72 79 20 20 20 20 20 20 20 20 20 20 20    entry           
005BE0:  20 3A 20 26 36 30 30 33 0D 0A 20 20 20 20 20 20     : &6003..      
005BF0:  20 20 20 20 20 20 20 20 20 20 20 20 20 2A 20 6D                 * m
005C00:  69 74 65 72 0D 0A 0D 0A 49 20 68 61 64 20 74 68    iter....I had th
005C10:  65 20 69 64 65 61 20 74 6F 20 63 6F 64 65 20 47    e idea to code G
005C20:  2E 57 2E 20 77 68 65 6E 20 49 20 72 65 63 65 69    .W. when I recei
005C30:  76 65 64 20 74 68 65 20 20 4B 61 6E 67 61 72 6F    ved the  Kangaro
005C40:  6F 27 73 20 4C 65 74 74 65 72 20 63 72 65 61 74    o's Letter creat
005C50:  6F 72 2E 20 46 6F 72 0D 0A 61 20 6C 6F 6E 67 20    or. For..a long 
005C60:  74 69 6D 65 2C 20 49 20 75 73 65 64 20 74 65 78    time, I used tex
005C70:  74 20 66 69 6C 65 73 20 74 6F 20 63 6F 72 72 65    t files to corre
005C80:  73 70 6F 6E 64 20 77 69 74 68 20 63 70 63 20 75    spond with cpc u
005C90:  73 65 72 73 2E 20 49 20 6C 69 6B 65 64 20 4B 61    sers. I liked Ka
005CA0:  6E 67 61 72 6F 6F 27 73 0D 0A 77 6F 72 6B 2C 20    ngaroo's..work, 
005CB0:  20 62 75 74 20 49 20 73 61 69 64 20 20 74 6F 20     but I said  to 
005CC0:  6D 79 73 65 6C 66 20 20 27 57 65 20 63 61 6E 20    myself  'We can 
005CD0:  64 6F 20 62 65 74 74 65 72 2E 27 20 2E 20 53 6F    do better.' . So
005CE0:  20 49 20 68 61 76 65 20 64 65 63 69 64 65 64 20     I have decided 
005CF0:  74 6F 20 6D 61 6B 65 20 61 0D 0A 6D 6F 72 65 20    to make a..more 
005D00:  70 6F 77 65 72 66 75 6C 20 77 72 69 74 65 72 2C    powerful writer,
005D10:  20 47 68 6F 75 6C 27 73 20 57 72 69 74 65 72 20     Ghoul's Writer 
005D20:  21 0D 0A 0D 0A 53 6F 6D 65 20 70 65 6F 70 6C 65    !....Some people
005D30:  20 6D 61 79 20 73 61 79 20 74 68 61 74 20 74 68     may say that th
005D40:  65 20 20 69 6E 74 72 6F 20 63 6F 64 69 6E 67 20    e  intro coding 
005D50:  69 73 20 6E 6F 74 20 67 72 65 61 74 20 20 28 6E    is not great  (n
005D60:  6F 20 6F 76 65 72 73 63 61 6E 2C 20 20 6E 6F 20    o overscan,  no 
005D70:  68 61 72 64 0D 0A 73 63 72 6F 6C 6C 2C 20 65 74    hard..scroll, et
005D80:  63 2E 2E 2E 20 29 2E 20 57 65 6C 6C 2C 20 69 6E    c... ). Well, in
005D90:  20 66 61 63 74 2C 20 20 49 20 77 61 6E 74 65 64     fact,  I wanted
005DA0:  20 74 6F 20 6D 61 6B 65 20 20 61 20 73 6F 66 74     to make  a soft
005DB0:  77 61 72 65 20 77 68 69 63 68 20 20 77 61 73 20    ware which  was 
005DC0:  66 75 6C 6C 79 20 0D 0A 63 6F 6D 70 61 74 69 62    fully ..compatib
005DD0:  6C 65 20 20 77 69 74 68 20 61 6C 6C 20 6B 69 6E    le  with all kin
005DE0:  64 20 20 6F 66 20 63 70 63 20 61 6E 64 20 63 72    d  of cpc and cr
005DF0:  74 63 2C 20 20 77 68 69 63 68 20 77 65 20 63 6F    tc,  which we co
005E00:  61 78 69 6D 75 6D 20 6C 65 6E 67 74 68 20 20 20    aximum length   
005E10:  3A 20 26 31 44 30 30 0D 0A 0D 0A 2E 46 4E 54 20    : &1D00.....FNT 
005E20:  66 69 6C 65 20 3A 20 54 41 4F 43 50 20 61 72 74    file : TAOCP art
005E30:  20 53 74 75 64 69 6F 20 63 68 61 72 73 65 74 0D     Studio charset.
005E40:  0A 0D 0A 20 20 20 20 20 20 20 20 20 20 20 20 49    ...            I
005E50:  6E 20 74 68 69 73 20 63 68 61 72 73 65 74 20 73    n this charset s
005E60:  74 72 75 63 74 75 72 65 2C 20 61 20 63 68 61 72    tructure, a char
005E70:  20 69 73 20 63 6F 64 65 64 20 6F 6E 20 38 20 62     is coded on 8 b
005E80:  79 74 65 73 20 28 6C 69 6B 65 20 61 20 6D 6F 64    ytes (like a mod
005E90:  65 0D 0A 20 20 20 20 20 20 20 20 20 20 20 20 32    e..            2
005EA0:  20 63 68 61 72 2C 20 20 75 70 20 74 6F 20 64 6F     char,  up to do
005EB0:  77 6E 29 2E 20 20 41 20 27 2E 46 4E 54 27 20 66    wn).  A '.FNT' f
005EC0:  69 6C 65 20 63 6F 6E 74 61 69 6E 73 20 20 64 61    ile contains  da
005ED0:  74 61 73 20 66 6F 72 20 74 68 65 20 41 53 43 49    tas for the ASCI
005EE0:  49 0D 0A 20 20 20 20 20 20 20 20 20 20 20 20 63    I..            c
005EF0:  68 61 72 73 20 33 32 20 74 6F 20 31 32 37 2E 0D    hars 32 to 127..
005F00:  0A 20 20 20 20 20 20 20 20 20 20 20 20 20 20 0D    .              .
005F10:  0A 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20    .               
005F20:  20 20 20 20 2A 20 2E 46 4E 54 20 66 69 6C 65 20        * .FNT file 
005F30:  6C 65 6E 67 74 68 20 20 3A 20 26 30 33 30 30 0D    length  : &0300.
005F40:  0A 0D 0A 2E 47 57 4C 20 66 69 6C 65 20 3A 20 6C    ....GWL file : l
005F50:  6F 67 6F 0D 0A 0D 0A 20 20 20 20 20 20 20 20 20    ogo....         
005F60:  20 20 20 46 69 6C 65 20 63 72 65 61 74 65 64 20       File created 
005F70:  77 69 74 68 20 2D 47 57 4C 4F 47 4F 2E 42 41 53    with -GWLOGO.BAS
005F80:  2E 20 49 74 20 69 73 20 6A 75 73 74 20 61 20 62    . It is just a b
005F90:  69 67 20 73 70 72 69 74 65 20 21 0D 0A 20 20 20    ig sprite !..   
005FA0:  20 20 20 20 20 20 20 20 20 20 20 0D 0A 20 20 20               ..   
005FB0:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
005FC0:  20 2A 20 2E 47 57 4C 20 66 69 6C 65 20 4C 65 6E     * .GWL file Len
005FD0:  67 74 68 20 3A 20 26 30 44 45 30 0D 0A 0D 0A 2E    gth : &0DE0.....
005FE0:  47 57 45 20 66 69 6C 65 20 3A 20 63 6C 65 61 72    GWE file : clear
005FF0:  73 63 72 65 65 6E 20 6D 65 74 68 6F 64 0D 0A 0D    screen method...
006000:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
006010:  05 00 01 00 02 09 4E E5 05 00 C1 02 00 00 00 02    ......N.........
006020:  05 00 C6 02 00 00 00 02 05 00 C2 02 00 00 00 02    ................
006030:  05 00 C7 02 00 00 00 02 05 00 C3 02 00 00 00 02    ................
006040:  05 00 C8 02 00 00 00 02 05 00 C4 02 00 00 00 02    ................
006050:  05 00 C9 02 00 00 00 02 05 00 C5 02 00 00 00 02    ................
006060:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
006070:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
006080:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
006090:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0060A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0060B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0060C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0060D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0060E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0060F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
006100:  75 6C 64 20 72 75 6E 20 75 6E 64 65 72 20 42 61    uld run under Ba
006110:  73 69 63 2E 20 49 74 0D 0A 6C 69 6D 69 74 65 64    sic. It..limited
006120:  20 74 68 65 20 77 61 79 20 6F 66 20 70 72 6F 67     the way of prog
006130:  72 61 6D 6D 69 6E 67 20 74 68 65 20 69 6E 74 72    ramming the intr
006140:  6F 64 75 63 74 69 6F 6E 20 62 61 73 69 63 20 72    oduction basic r
006150:  6F 75 74 69 6E 65 73 2E 0D 0A 0D 0A 41 6C 6C 20    outines.....All 
006160:  64 61 74 61 66 69 6C 65 73 20 20 28 6D 75 73 69    datafiles  (musi
006170:  63 73 2C 20 61 6E 69 6D 61 74 69 6F 6E 73 2C 20    cs, animations, 
006180:  63 6C 69 70 2D 61 72 74 73 29 20 61 72 65 20 70    clip-arts) are p
006190:  65 72 73 6F 6E 61 6C 20 63 72 65 61 74 69 6F 6E    ersonal creation
0061A0:  73 2E 20 20 59 6F 75 20 61 72 65 0D 0A 61 75 74    s.  You are..aut
0061B0:  68 6F 72 69 7A 65 64 20 74 6F 20 75 73 65 20 74    horized to use t
0061C0:  68 65 6D 20 66 72 65 65 6C 79 2E 20 20 49 74 20    hem freely.  It 
0061D0:  77 6F 75 6C 64 20 20 62 65 20 6E 69 63 65 20 74    would  be nice t
0061E0:  6F 20 74 65 6C 6C 20 20 77 68 65 72 65 20 74 68    o tell  where th
0061F0:  65 79 20 63 6F 6D 65 20 66 72 6F 6D 0D 0A 69 66    ey come from..if
006200:  20 79 6F 75 20 74 61 6B 65 20 74 68 65 6D 20 66     you take them f
006210:  6F 72 20 79 6F 75 72 20 6F 77 6E 20 70 69 65 63    or your own piec
006220:  65 73 20 6F 66 20 73 6F 66 74 77 61 72 65 2E 0D    es of software..
006230:  0A 54 68 65 6D 69 73 20 20 53 49 4C 56 45 52 4D    .Themis  SILVERM
006240:  41 2E 4D 55 53 20 20 61 6E 64 20 59 45 53 4F 44    A.MUS  and YESOD
006250:  2E 4D 55 53 20 20 61 72 65 20 62 61 73 65 64 20    .MUS  are based 
006260:  6F 6E 20 74 77 6F 20 67 61 6D 65 20 6D 75 73 69    on two game musi
006270:  63 73 20 28 62 75 74 20 61 72 65 20 70 75 72 65    cs (but are pure
006280:  0D 0A 53 6F 75 6E 64 74 72 61 6B 6B 65 72 27 73    ..Soundtrakker's
006290:  20 74 75 6E 65 73 20 21 29 20 3A 0D 0A 0D 0A 20     tunes !) :.... 
0062A0:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 2D                   -
0062B0:  20 4B 65 6E 27 73 20 6C 61 62 79 72 69 6E 74 68     Ken's labyrinth
0062C0:  20 33 64 20 28 50 43 29 20 66 72 6F 6D 20 4B 65     3d (PC) from Ke
0062D0:  6E 20 53 69 6C 76 65 72 6D 61 6E 20 21 0D 0A 20    n Silverman !.. 
0062E0:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 2D                   -
0062F0:  20 4E 6F 64 65 73 20 6F 66 20 59 65 73 6F 64 20     Nodes of Yesod 
006300:  00 49 4E 54 52 4F 20 20 20 44 41 54 00 00 00 00    .INTRO   DAT....
006310:  00 00 02 00 00 00 90 00 00 06 00 00 00 00 00 00    ................
006320:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
006330:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
006340:  00 06 00 63 03 00 00 49 4E 54 52 4F 20 20 20 24    ...c...INTRO   $
006350:  24 24 FF 00 FF 94 23 CD AD 94 C3 F7 94 2A 15 94    $$....#......*..
006360:  22 0F 94 AF 32 11 94 32 12 94 32 19 90 32 60 95    "...2..2..2..2`.
006370:  3D 32 61 95 21 06 C2 22 13 94 C9 3A 18 90 F5 3E    =2a.!.."...:...>
006380:  C3 2B 90 4B 54 01 54 54 54 54 54 54 54 54 54 54    .+.KT.TTTTTTTTTT
006390:  54 54 54 54 54 54 54 41 01 00 57 57 53 4B 4B 53    TTTTTTTA..WWSKKS
0063A0:  57 57 04 01 00 00 60 8F 00 00 00 CD 14 BC F3 2A    WW....`........*
0063B0:  38 00 22 29 90 21 FB C9 22 38 00 08 F5 08 01 01    8.").!.."8......
0063C0:  BC ED 49 01 25 BD ED 49 01 02 BC ED 49 01 2C BD    ..I.%..I....I.,.
0063D0:  ED 49 01 06 BC ED 49 01 1B BD ED 49 01 07 BC ED    .I....I....I....
0063E0:  49 01 20 BD ED 49 01 05 BC ED 49 01 01 BD ED 49    I. ..I....I....I
0063F0:  3E 10 21 06 90 01 00 7F ED 49 5E ED 59 0C 23 3D    >.!......I^.Y.#=
006400:  20 F6 3A 06 90 32 75 91 0E 8D 3A 18 90 A7 20 01     .:..2u...:... .
006410:  0C 79 32 56 91 0E 8C 3A 05 90 A7 28 01 0C 79 32    .y2V...:...(..y2
006420:  DD 90 CD 26 92 CD 00 60 CD 00 96 3A 24 90 A7 C4    ...&...`...:$...
006430:  09 94 CD 06 94 3A 23 90 A7 20 0F 21 03 94 3A 25    .....:#.. .!..:%
006440:  90 FE 02 28 08 21 0C 94 18 03 21 00 94 22 09 91    ...(.!....!.."..
006450:  3E FF 32 7A 92 06 F5 ED 78 1F 30 FB 01 8D 7F ED    >.2z....x.0.....
006460:  49 0E 10 ED 49 3A 06 90 ED 79 0E 00 ED 49 ED 79    I...I:...y...I.y
006470:  0C ED 49 3A 07 90 ED 79 0C ED 49 3A 08 90 ED 79    ..I:...y..I:...y
006480:  0C ED 49 3A 09 90 ED 79 CD 03 94 3A 7A 92 FE 7F    ..I:...y...:z...
006490:  20 0E 3A 19 90 A7 CA 2E 91 3E FF 32 28 90 18 03     .:......>.2(...
0064A0:  3A 28 90 A7 C4 BA 91 3A 28 90 A7 C4 BA 91 3A 04    :(.....:(.....:.
0064B0:  90 32 AC 91 CD 66 93 FB 76 F3 CD 03 96 FB 76 F3    .2...f..v.....v.
0064C0:  FB 76 F3 CD 8E 91 3A 17 90 01 02 7F ED 49 ED 79    .v....:......I.y
0064D0:  0C ED 49 ED 79 01 8D 7F ED 49 CD C5 92 FB 76 F3    ..I.y....I....v.
0064E0:  00 00 06 2C 10 FE 3A 06 90 32 AC 91 CD 8E 91 01    ...,..:..2......
0064F0:  8D 7F ED 49 3E 54 01 01 7F ED 49 ED 79 CD 43 92    ...I>T....I.y.C.
006500:  28 43 50 43 29 20 66 72 6F 6D 20 4F 64 69 6E 20    (CPC) from Odin 
006510:  73 6F 66 74 77 61 72 65 2E 0D 0A 0D 0A 47 68 6F    software.....Gho
006520:  75 6C 27 73 20 57 72 69 74 65 72 20 69 73 20 61    ul's Writer is a
006530:  20 53 48 41 52 45 57 41 52 45 20 50 52 4F 47 52     SHAREWARE PROGR
006540:  41 4D 2E 20 20 59 6F 75 20 63 61 6E 20 63 6F 70    AM.  You can cop
006550:  79 20 69 74 20 66 72 65 65 6C 79 20 74 6F 20 79    y it freely to y
006560:  6F 75 72 20 66 72 69 65 6E 64 73 2C 0D 0A 64 69    our friends,..di
006570:  73 70 61 74 63 68 20 69 74 20 69 6E 20 66 61 6E    spatch it in fan
006580:  7A 69 6E 65 73 20 6F 72 20 69 6E 20 50 75 62 6C    zines or in Publ
006590:  69 63 20 44 6F 6D 61 69 6E 20 63 6F 6D 70 69 6C    ic Domain compil
0065A0:  61 74 69 6F 6E 2E 20 42 75 74 2C 20 79 6F 75 20    ation. But, you 
0065B0:  64 6F 20 6E 6F 74 20 6D 6F 64 69 66 79 0D 0A 70    do not modify..p
0065C0:  72 6F 67 72 61 6D 73 20 6F 72 20 64 61 74 61 66    rograms or dataf
0065D0:  69 6C 65 73 2E 0D 0A 0D 0A 49 66 20 79 6F 75 20    iles.....If you 
0065E0:  61 72 65 20 61 20 72 65 67 75 6C 61 72 20 75 73    are a regular us
0065F0:  65 72 20 6F 66 20 47 68 6F 75 6C 27 73 20 57 72    er of Ghoul's Wr
006600:  69 74 65 72 2C 20 79 6F 75 20 68 61 76 65 20 74    iter, you have t
006610:  6F 20 70 61 79 20 61 20 6C 69 74 74 6C 65 20 62    o pay a little b
006620:  69 6C 6C 20 20 61 6E 64 0D 0A 62 65 63 6F 6D 65    ill  and..become
006630:  20 61 20 72 65 67 69 73 74 65 72 65 64 20 75 73     a registered us
006640:  65 72 20 3A 0D 0A 0D 0A 20 20 20 20 20 20 20 20    er :....        
006650:  20 20 20 20 20 20 20 20 20 20 20 2A 20 33 30 20               * 30 
006660:  66 72 65 6E 63 68 20 66 72 61 6E 63 73 20 28 74    french francs (t
006670:  69 6D 62 72 65 73 2C 20 62 69 6C 6C 65 74 2C 20    imbres, billet, 
006680:  63 68 65 71 75 65 2C 20 70 69 65 63 65 73 29 0D    cheque, pieces).
006690:  0A 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20    .               
0066A0:  20 20 20 20 2A 20 36 20 55 2E 53 20 64 6F 6C 6C        * 6 U.S doll
0066B0:  61 72 73 20 28 62 61 6E 6B 6E 6F 74 65 20 6F 6E    ars (banknote on
0066C0:  6C 79 29 0D 0A 20 20 20 20 20 20 20 20 20 20 20    ly)..           
0066D0:  20 20 20 20 20 20 20 20 2A 20 31 30 20 44 65 75            * 10 Deu
0066E0:  74 73 63 68 6D 61 72 6B 73 20 28 62 61 6E 6B 6E    tschmarks (bankn
0066F0:  6F 74 65 20 6F 6E 6C 79 20 21 29 0D 0A 20 20 20    ote only !)..   
006700:  3A 7B 92 FE FB CA 7C 92 CD 03 60 C3 D5 90 06 04    :{....|...`.....
006710:  00 10 FD 01 10 7F 3A 03 90 ED 49 ED 79 0E 00 ED    ......:...I.y...
006720:  49 ED 79 21 F0 FF 23 7C A7 20 FB 3E 54 0E 10 ED    I.y!..#|. .>T...
006730:  49 ED 79 0E 00 ED 49 ED 79 C9 2A 26 90 7E FE FF    I.y...I.y.*&.~..
006740:  CA 18 92 23 22 26 90 21 BC C1 01 4A 00 09 D6 08    ...#"&.!...J....
006750:  30 FB C6 08 01 00 08 A7 28 04 09 3D 20 FC 0E 00    0.......(..= ...
006760:  3A 18 90 A7 28 02 0E 0F 06 08 7E A1 77 23 7E A1    :...(.....~.w#~.
006770:  77 23 7E A1 77 23 7E A1 77 23 7E A1 77 23 7E A1    w#~.w#~.w#~.w#~.
006780:  77 23 7E A1 77 23 7E A1 77 23 7E A1 77 23 10 DA    w#~.w#~.w#~.w#..
006790:  7E A1 77 23 7E A1 77 C9 AF 32 28 90 32 19 90 21    ~.w#~.w..2(.2..!
0067A0:  60 8F 22 26 90 C9 3E 30 21 00 7E 11 00 C0 01 4A    `."&..>0!.~....J
0067B0:  00 ED B0 EB 01 B6 07 09 30 04 01 4A C0 09 EB 3D    ........0..J...=
0067C0:  20 EC C9 21 7A 92 01 0E F4 ED 49 01 C0 F6 ED 49     ..!z.....I....I
0067D0:  AF ED 79 01 92 F7 ED 49 0E 45 06 F6 ED 49 06 F4    ..y....I.E...I..
0067E0:  ED 78 77 23 0E 48 06 F6 ED 49 06 F4 ED 78 77 01    .xw#.H...I...xw.
0067F0:  82 F7 ED 49 01 00 F6 ED 49 C9 00 00 F3 01 01 BC    ...I....I.......
006800:  ED 49 01 28 BD ED 49 01 02 BC ED 49 01 2E BD ED    .I.(..I....I....
006810:  49 01 06 BC ED 49 01 19 BD ED 49 01 07 BC ED 49    I....I....I....I
006820:  01 1E BD ED 49 01 05 BC ED 49 01 00 BD ED 49 2A    ....I....I....I*
006830:  29 90 22 38 00 08 F1 08 CD 9A 93 CD 06 96 FB CD    )."8............
006840:  A7 BC C3 00 BB E1 06 2F 10 FE 3E 12 1E 0D 01 01    ......./..>.....
006850:  7F DD 21 1A 90 ED 49 08 DD 7E 00 ED 79 00 00 00    ..!...I..~..y...
006860:  7B 3D 20 FD DD 7E 01 ED 79 00 00 00 7B 3D 20 FD    {= ..~..y...{= .
006870:  DD 7E 02 ED 79 00 00 00 7B 3D 20 FD DD 7E 03 ED    .~..y...{= ..~..
006880:  79 00 00 00 7B 3D 20 FD DD 7E 04 ED 79 00 00 00    y...{= ..~..y...
006890:  7B 3D 20 FD DD 7E 05 ED 79 00 00 00 7B 3D 20 FD    {= ..~..y...{= .
0068A0:  DD 7E 06 ED 79 00 00 00 7B 3D 20 FD DD 7E 07 ED    .~..y...{= ..~..
0068B0:  79 7B 3D 3D 20 FD 08 3D 20 9D 3E 54 ED 79 C3 5D    y{== ..= .>T.y.]
0068C0:  91 54 54 54 50 50 50 55 55 55 53 53 53 49 49 49    .TTTPPPUUUSSSIII
0068D0:  4B 4B 4B 4B 4B 4B 49 49 49 53 53 53 55 55 55 50    KKKKKKIIISSSUUUP
0068E0:  50 50 54 54 54 00 3A 24 90 A7 C8 3A 19 90 FE FF    PPTTT.:$...:....
0068F0:  20 19 3A 28 90 A7 20 13 2A 98 93 7E A7 20 04 21     .:(.. .*..~. .!
006900:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
006910:  2A 20 33 20 70 6F 75 6E 64 73 20 28 62 61 6E 6B    * 3 pounds (bank
006920:  6E 6F 74 65 20 6F 72 20 63 6F 69 6E 73 29 0D 0A    note or coins)..
006930:  0D 0A 49 20 73 74 69 6C 6C 20 64 6F 6E 27 74 20    ..I still don't 
006940:  6D 61 6B 65 20 65 6D 70 74 79 20 64 72 65 61 6D    make empty dream
006950:  73 20 61 62 6F 75 74 20 74 68 65 20 66 69 6E 61    s about the fina
006960:  6E 63 61 6C 20 69 6E 63 6F 6D 65 73 20 6F 66 20    ncal incomes of 
006970:  47 2E 57 2E 20 20 4F 6E 6C 79 20 73 65 76 65 6E    G.W.  Only seven
006980:  0D 0A 63 70 63 20 75 73 65 72 73 20 68 61 76 65    ..cpc users have
006990:  20 72 65 67 69 73 74 65 72 65 64 20 66 6F 72 20     registered for 
0069A0:  4D 75 6C 74 69 20 4D 61 72 6B 20 31 2E 30 2E 20    Multi Mark 1.0. 
0069B0:  54 68 61 74 27 73 20 6E 6F 74 20 61 20 72 65 73    That's not a res
0069C0:  6F 6E 20 66 6F 72 20 6E 6F 74 20 64 6F 69 6E 67    on for not doing
0069D0:  0D 0A 69 74 2C 20 6F 6B 20 3F 20 20 52 65 67 69    ..it, ok ?  Regi
0069E0:  73 74 72 61 74 69 6F 6E 20 74 61 72 69 66 66 73    stration tariffs
0069F0:  20 61 72 65 20 68 69 67 68 65 72 20 74 68 61 6E     are higher than
006A00:  20 4D 75 6C 74 69 20 4D 61 72 6B 20 6F 6E 65 73     Multi Mark ones
006A10:  2E 20 57 68 79 20 3F 20 4F 6E 6C 79 20 62 65 2D    . Why ? Only be-
006A20:  0D 0A 63 61 75 73 65 20 47 2E 57 20 20 74 61 6B    ..cause G.W  tak
006A30:  65 73 20 61 20 76 65 72 79 20 6C 6F 6E 67 20 20    es a very long  
006A40:  74 69 6D 65 20 74 6F 20 72 65 61 6C 69 7A 65 20    time to realize 
006A50:  69 74 2E 20 4D 61 6B 69 6E 67 20 61 20 6C 6F 74    it. Making a lot
006A60:  20 6F 66 20 64 61 74 61 66 69 6C 65 73 20 69 73     of datafiles is
006A70:  0D 0A 72 65 61 6C 6C 79 20 20 64 69 66 66 69 63    ..really  diffic
006A80:  75 6C 74 2C 20 79 6F 75 20 6B 6E 6F 77 20 21 0D    ult, you know !.
006A90:  0A 0D 0A 59 6F 75 20 77 61 6E 74 20 74 6F 20 63    ...You want to c
006AA0:  6F 6E 74 61 63 74 20 6D 65 20 74 6F 20 72 65 67    ontact me to reg
006AB0:  69 73 74 65 72 2C 20 74 6F 20 74 61 6C 6B 20 61    ister, to talk a
006AC0:  62 6F 75 74 20 70 72 6F 62 6C 65 6D 73 20 6F 72    bout problems or
006AD0:  20 62 75 67 73 20 28 49 20 68 6F 70 65 20 6E 6F     bugs (I hope no
006AE0:  74 29 0D 0A 6F 72 20 6A 75 73 74 20 74 6F 20 73    t)..or just to s
006AF0:  65 6E 64 20 79 6F 75 72 20 6D 75 73 69 63 73 20    end your musics 
006B00:  41 93 7E 32 75 91 23 22 98 93 C9 3A 06 90 32 75    A.~2u.#"...:..2u
006B10:  91 21 41 93 22 98 93 C9 41 93 21 00 C0 11 01 C0    .!A."...A.!.....
006B20:  01 FF 3F 75 ED B0 C9 00 00 00 00 00 00 00 00 00    ..?u............
006B30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
006B40:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
006B50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
006B60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
006B70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
006B80:  C3 62 95 C3 17 94 C3 98 95 C3 B6 95 C3 DF 95 F4    .b..............
006B90:  11 00 00 06 C2 F4 11 3A 19 90 FE FF C8 4F 3A 11    .......:.....O:.
006BA0:  94 FE 4A CA A0 94 79 2A 0F 94 7E FE 0D CA A9 94    ..J...y*..~.....
006BB0:  FE 09 CA E2 94 23 22 0F 94 21 F0 8B D6 20 A7 28    .....#"..!... .(
006BC0:  09 E5 26 00 6F 29 29 29 C1 09 E5 2A 13 94 3A 11    ..&.o)))...*..:.
006BD0:  94 06 00 4F 09 3A 18 90 A7 20 17 3A 11 94 3C 32    ...O.:... .:..<2
006BE0:  11 94 D1 3E 08 01 00 08 08 1A 77 08 13 09 3D 20    ...>......w...= 
006BF0:  F7 C9 3A 11 94 C6 02 32 11 94 D1 3E 08 0E FF 08    ..:....2...>....
006C00:  1A E6 F0 47 7E E6 0F 80 77 23 1A E6 0F 17 17 17    ...G~...w#......
006C10:  17 47 7E E6 0F 80 77 13 06 07 09 08 3D 20 E0 C9    .G~...w.....= ..
006C20:  AF 32 11 94 2A 0F 94 18 04 23 22 0F 94 AF 32 11    .2..*....#"...2.
006C30:  94 7E FE 0A 28 16 3A 12 94 3C FE 12 28 14 32 12    .~..(.:..<..(.2.
006C40:  94 2A 13 94 01 4A 00 09 22 13 94 C9 2A 15 94 22    .*...J.."...*.."
006C50:  0F 94 AF 32 12 94 3E FF 32 19 90 21 06 C2 22 13    ...2..>.2..!..".
006C60:  94 C9 3A 18 90 A7 20 0A 23 7E 32 11 94 23 22 0F    ..:... .#~2..#".
006C70:  94 C9 23 7E 87 18 F3 3A 19 90 FE FF C8 AF 32 61    ..#~...:......2a
006C80:  95 2A 0F 94 7E FE 0D C8 FE FF C8 FE 09 C8 21 58    .*..~.........!X
006C90:  95 E5 2A 13 94 3A 11 94 06 00 4F 09 3A 18 90 A7    ..*..:....O.:...
006CA0:  20 10 D1 3E 08 01 00 08 08 1A 77 08 13 09 3D 20     ..>......w...= 
006CB0:  F7 C9 D1 3E 08 0E FF 08 1A E6 F0 47 7E E6 0F 80    ...>.......G~...
006CC0:  77 23 1A E6 0F 87 87 87 87 47 7E E6 0F 80 77 13    w#.......G~...w.
006CD0:  06 07 09 08 3D 20 E0 C9 FF FF FF FF FF FF FF FF    ....= ..........
006CE0:  00 FF 21 22 90 3A 60 95 3C BE 28 06 32 60 95 C3    ..!".:`.<.(.2`..
006CF0:  F7 94 AF 32 60 95 3A 61 95 FE FF 28 18 CD 17 94    ...2`.:a...(....
006D00:  6F 72 20 63 6C 69 70 2D 61 72 74 73 20 66 6F 72    or clip-arts for
006D10:  20 61 20 47 68 6F 75 6C 27 73 20 57 72 69 74 65     a Ghoul's Write
006D20:  72 20 64 61 74 61 20 64 69 73 6B 20 3F 0D 0A 57    r data disk ?..W
006D30:  72 69 74 65 20 74 6F 20 3A 0D 0A 0D 0A 20 20 20    rite to :....   
006D40:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
006D50:  20 20 20 20 20 20 20 20 4D 6F 6E 63 68 61 74 72            Monchatr
006D60:  65 20 48 65 72 76 65 0D 0A 20 20 20 20 20 20 20    e Herve..       
006D70:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
006D80:  20 20 20 20 43 6F 6C 6C 65 67 65 2C 20 31 20 72        College, 1 r
006D90:  75 65 20 64 65 73 20 6F 72 6D 65 73 0D 0A 20 20    ue des ormes..  
006DA0:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
006DB0:  20 20 20 20 20 20 20 20 20 34 35 33 32 30 20 43             45320 C
006DC0:  6F 75 72 74 65 6E 61 79 0D 0A 20 20 20 20 20 20    ourtenay..      
006DD0:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
006DE0:  20 20 20 20 20 46 72 61 6E 63 65 0D 0A 0D 0A 4F         France....O
006DF0:  6E 65 20 20 6C 69 74 74 6C 65 20 61 6E 65 63 64    ne  little anecd
006E00:  6F 74 65 20 74 6F 20 66 69 6E 69 73 68 2E 20 20    ote to finish.  
006E10:  44 6F 20 79 6F 75 20 6B 6E 6F 77 20 77 68 65 72    Do you know wher
006E20:  65 20 74 68 65 20 6E 61 6D 65 20 20 6F 66 20 74    e the name  of t
006E30:  68 69 73 20 77 72 69 74 65 72 20 63 6F 2D 0D 0A    his writer co-..
006E40:  6D 65 73 20 66 72 6F 6D 20 3F 20 20 49 74 27 73    mes from ?  It's
006E50:  20 61 20 20 70 6C 61 79 20 6F 6E 20 77 6F 72 64     a  play on word
006E60:  73 20 20 62 61 73 65 64 20 6F 6E 20 74 77 6F 20    s  based on two 
006E70:  63 70 63 20 70 72 6F 67 72 61 6D 73 20 20 6E 61    cpc programs  na
006E80:  6D 65 73 20 3A 20 74 68 65 20 47 68 6F 73 74 0D    mes : the Ghost.
006E90:  0A 57 72 69 74 65 72 20 6F 66 20 4D 54 49 20 61    .Writer of MTI a
006EA0:  6E 64 20 61 6E 20 6F 6C 64 20 43 50 43 20 67 61    nd an old CPC ga
006EB0:  6D 65 20 70 75 62 6C 69 73 68 65 64 20 62 79 20    me published by 
006EC0:  55 2E 53 2E 47 6F 6C 64 2C 20 47 68 6F 75 6C 27    U.S.Gold, Ghoul'
006ED0:  73 27 6E 27 67 68 6F 73 74 73 2E 0D 0A 0D 0A 53    s'n'ghosts.....S
006EE0:  6F 75 6E 64 74 72 61 6B 6B 65 72 20 28 63 29 20    oundtrakker (c) 
006EF0:  4E 65 77 20 61 67 65 20 53 6F 66 74 77 61 72 65    New age Software
006F00:  3A 12 94 FE 11 20 0E 3A 11 94 FE 4A 20 07 2A 0F    :.... .:...J .*.
006F10:  94 23 CD AD 94 C3 F7 94 2A 15 94 22 0F 94 AF 32    .#......*.."...2
006F20:  11 94 32 12 94 32 19 90 32 60 95 3D 32 61 95 21    ..2..2..2`.=2a.!
006F30:  06 C2 22 13 94 C9 3A 18 90 F5 3E 01 32 18 90 CD    .."...:...>.2...
006F40:  98 95 21 91 C7 22 13 94 21 E5 95 22 0F 94 2A 0F    ..!.."..!.."..*.
006F50:  94 7E A7 28 05 CD 17 94 18 F4 F1 32 18 90 C9 CD    .~.(.......2....
006F60:  17 94 C3 17 94 50 72 65 73 73 20 73 70 61 63 65    .....Press space
006F70:  20 74 6F 20 63 6F 6E 74 69 6E 75 65 00 00 00 00     to continue....
006F80:  C3 62 95 C3 17 94 C3 98 95 C3 B6 95 C3 DF 95 F4    .b..............
006F90:  11 00 00 06 C2 F4 11 3A 19 90 FE FF C8 4F 3A 11    .......:.....O:.
006FA0:  94 FE 4A CA A0 94 79 2A 0F 94 7E FE 0D CA A9 94    ..J...y*..~.....
006FB0:  FE 09 CA E2 94 23 22 0F 94 21 F0 8B D6 20 A7 28    .....#"..!... .(
006FC0:  09 E5 26 00 6F 29 29 29 C1 09 E5 2A 13 94 3A 11    ..&.o)))...*..:.
006FD0:  94 06 00 4F 09 3A 18 90 A7 20 17 3A 11 94 3C 32    ...O.:... .:..<2
006FE0:  11 94 D1 3E 08 01 00 08 08 1A 77 08 13 09 3D 20    ...>......w...= 
006FF0:  F7 C9 3A 11 94 C6 02 32 11 94 D1 3E 08 0E FF 08    ..:....2...>....
007000:  1A E6 F0 47 7E E6 0F 80 77 23 1A E6 0F 17 17 17    ...G~...w#......
007010:  17 47 7E E6 0F 80 77 13 06 07 09 08 3D 20 E0 C9    .G~...w.....= ..
007020:  AF 32 11 94 2A 0F 94 18 04 23 22 0F 94 AF 32 11    .2..*....#"...2.
007030:  94 7E FE 0A 28 16 3A 12 94 3C FE 12 28 14 32 12    .~..(.:..<..(.2.
007040:  94 2A 13 94 01 4A 00 09 22 13 94 C9 2A 15 94 22    .*...J.."...*.."
007050:  0F 94 AF 32 12 94 3E FF 32 19 90 21 06 C2 22 13    ...2..>.2..!..".
007060:  94 C9 3A 18 90 A7 20 0A 23 7E 32 11 94 23 22 0F    ..:... .#~2..#".
007070:  94 C9 23 7E 87 18 F3 3A 19 90 FE FF C8 AF 32 61    ..#~...:......2a
007080:  95 2A 0F 94 7E FE 0D C8 FE FF C8 FE 09 C8 21 58    .*..~.........!X
007090:  95 E5 2A 13 94 3A 11 94 06 00 4F 09 3A 18 90 A7    ..*..:....O.:...
0070A0:  20 10 D1 3E 08 01 00 08 08 1A 77 08 13 09 3D 20     ..>......w...= 
0070B0:  F7 C9 D1 3E 08 0E FF 08 1A E6 F0 47 7E E6 0F 80    ...>.......G~...
0070C0:  77 23 1A E6 0F 87 87 87 87 47 7E E6 0F 80 77 13    w#.......G~...w.
0070D0:  06 07 09 08 3D 20 E0 C9 FF FF FF FF FF FF FF FF    ....= ..........
0070E0:  00 FF 21 22 90 3A 60 95 3C BE 28 06 32 60 95 C3    ..!".:`.<.(.2`..
0070F0:  F7 94 AF 32 60 95 3A 61 95 FE FF 28 18 CD 17 94    ...2`.:a...(....
007100:  0D 0A 54 68 65 20 41 64 76 61 6E 63 65 64 20 4F    ..The Advanced O
007110:  43 50 20 41 72 74 20 53 74 75 64 69 6F 20 28 63    CP Art Studio (c
007120:  29 20 52 61 69 6E 62 69 72 64 0D 0A 0D 0A 1A 0D    ) Rainbird......
007130:  0A 0D 0A 20 20 20 20 20 20 20 20 20 20 20 20 20    ...             
007140:  20 20 20 20 20 20 20 20 20 54 6F 6D 20 65 74 20             Tom et 
007150:  4A 65 72 72 79 20 6F 66 20 47 50 41 20 28 63 29    Jerry of GPA (c)
007160:  20 31 39 39 34 0D 0A 0D 0A 20 20 20 20 20 20 20     1994....       
007170:  20 20 20 20 20 20 20 20 20 20 20 20 2A 20 54 68                * Th
007180:  20 20 20 20 43 6F 6C 6C 65 67 65 2C 20 31 20 72        College, 1 r
007190:  75 65 20 64 65 73 20 6F 72 6D 65 73 0D 0A 20 20    ue des ormes..  
0071A0:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
0071B0:  20 20 20 20 20 20 20 20 20 34 35 33 32 30 20 43             45320 C
0071C0:  6F 75 72 74 65 6E 61 79 0D 0A 20 20 20 20 20 20    ourtenay..      
0071D0:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
0071E0:  20 20 20 20 20 46 72 61 6E 63 65 0D 0A 0D 0A 4F         France....O
0071F0:  6E 65 20 20 6C 69 74 74 6C 65 20 61 6E 65 63 64    ne  little anecd
007200:  6F 74 65 20 74 6F 20 66 69 6E 69 73 68 2E 20 20    ote to finish.  
007210:  44 6F 20 79 6F 75 20 6B 6E 6F 77 20 77 68 65 72    Do you know wher
007220:  65 20 74 68 65 20 6E 61 6D 65 20 20 6F 66 20 74    e the name  of t
007230:  68 69 73 20 77 72 69 74 65 72 20 63 6F 2D 0D 0A    his writer co-..
007240:  6D 65 73 20 66 72 6F 6D 20 3F 20 20 49 74 27 73    mes from ?  It's
007250:  20 61 20 20 70 6C 61 79 20 6F 6E 20 77 6F 72 64     a  play on word
007260:  73 20 20 62 61 73 65 64 20 6F 6E 20 74 77 6F 20    s  based on two 
007270:  63 70 63 20 70 72 6F 67 72 61 6D 73 20 20 6E 61    cpc programs  na
007280:  6D 65 73 20 3A 20 74 68 65 20 47 68 6F 73 74 0D    mes : the Ghost.
007290:  0A 57 72 69 74 65 72 20 6F 66 20 4D 54 49 20 61    .Writer of MTI a
0072A0:  6E 64 20 61 6E 20 6F 6C 64 20 43 50 43 20 67 61    nd an old CPC ga
0072B0:  6D 65 20 70 75 62 6C 69 73 68 65 64 20 62 79 20    me published by 
0072C0:  55 2E 53 2E 47 6F 6C 64 2C 20 47 68 6F 75 6C 27    U.S.Gold, Ghoul'
0072D0:  73 27 6E 27 67 68 6F 73 74 73 2E 0D 0A 0D 0A 53    s'n'ghosts.....S
0072E0:  6F 75 6E 64 74 72 61 6B 6B 65 72 20 28 63 29 20    oundtrakker (c) 
0072F0:  4E 65 77 20 61 67 65 20 53 6F 66 74 77 61 72 65    New age Software
007300:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
007310:  06 00 01 00 02 09 4E E5 06 00 C1 02 00 00 00 02    ......N.........
007320:  06 00 C6 02 00 00 00 02 06 00 C2 02 00 00 00 02    ................
007330:  06 00 C7 02 00 00 00 02 06 00 C3 02 00 00 00 02    ................
007340:  06 00 C8 02 00 00 00 02 06 00 C4 02 00 00 00 02    ................
007350:  06 00 C9 02 00 00 00 02 06 00 C5 02 00 00 00 02    ................
007360:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007370:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007380:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007390:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0073A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0073B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0073C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0073D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0073E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0073F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007400:  00 4C 49 4E 45 20 20 20 20 47 57 45 00 00 00 00    .LINE    GWE....
007410:  00 00 02 00 00 00 90 00 91 00 00 00 00 00 00 00    ................
007420:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007430:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007440:  91 00 00 3F 04 60 61 62 63 64 65 66 67 70 71 72    ...?.`abcdefgpqr
007450:  73 74 75 76 77 FF 1A AA AA 55 55 55 55 AA AA AA    stuvw....UUUU...
007460:  AA 55 55 55 55 AA AA AA AA 55 55 55 55 AA AA AA    .UUUU....UUUU...
007470:  AA 55 55 55 55 AA AA AA AA 55 55 02 70 01 70 01    .UUUU....UU.p.p.
007480:  50 51 52 53 54 55 56 57 08 09 0A 0B 0C 0D 0E 0F    PQRSTUVW........
007490:  40 41 42 43 44 45 46 47 78 79 7A 7B 7C 7D 7E 7F    @ABCDEFGxyz{|}~.
0074A0:  18 19 1A 1B 1C 1D 1E 1F 28 29 2A 2B 2C 2D 2E 2F    ........()*+,-./
0074B0:  88 89 8A 8B 8C 8D 8E 8F 48 49 4A 4B 4C 4D 4E 4F    ........HIJKLMNO
0074C0:  38 39 3A 3B 3C 3D 3E 3F 00 01 02 03 04 05 06 07    89:;<=>?........
0074D0:  68 69 6A 6B 6C 6D 6E 6F 10 11 12 13 14 15 16 17    hijklmno........
0074E0:  30 31 32 33 34 35 36 37 80 81 82 83 84 85 86 87    01234567........
0074F0:  58 59 5A 5B 5C 5D 5E 5F 20 21 22 23 24 25 26 27    XYZ[\]^_ !"#$%&'
007500:  60 61 62 63 64 65 66 67 70 71 72 73 74 75 76 77    `abcdefgpqrstuvw
007510:  FF 1A AA AA 55 55 55 55 AA AA AA AA 55 55 55 55    ....UUUU....UUUU
007520:  AA AA AA AA 55 55 55 55 AA AA AA AA 55 55 55 55    ....UUUU....UUUU
007530:  AA AA AA AA 55 55 02 70 01 70 01 00 4C 49 47 4E    ....UU.p.p..LIGN
007540:  45 20 20 20 42 41 53 00 00 00 00 00 00 00 00 00    E   BAS.........
007550:  70 01 00 C9 00 00 00 00 00 00 00 00 00 00 00 00    p...............
007560:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007570:  00 00 00 00 00 00 00 00 00 00 00 C9 00 00 A8 04    ................
007580:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
007590:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0075A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0075B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0075C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0075D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0075E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0075F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
007600:  03 60 C3 C5 90 06 04 00 10 FD 01 10 7F 3A 03 90    .`...........:..
007610:  ED 49 ED 79 0E 00 ED 49 ED 79 21 F0 FF 23 7C A7    .I.y...I.y!..#|.
007620:  20 FB 3E 54 0E 10 ED 49 ED 79 0E 00 ED 49 ED 79     .>T...I.y...I.y
007630:  C9 2A 24 90 7E FE FF CA 0F 92 23 22 24 90 21 BC    .*$.~.....#"$.!.
007640:  C1 01 4A 00 09 D6 08 30 FB C6 08 01 00 08 A7 28    ..J....0.......(
007650:  04 09 3D 20 FC 0E 00 3A 18 90 A7 28 02 0E 0F 06    ..= ...:...(....
007660:  08 7E A1 77 23 7E A1 77 23 7E A1 77 23 7E A1 77    .~.w#~.w#~.w#~.w
007670:  23 7E A1 77 23 7E A1 77 23 7E A1 77 23 7E A1 77    #~.w#~.w#~.w#~.w
007680:  23 7E A1 77 23 10 DA 7E A1 77 23 7E A1 77 C9 AF    #~.w#..~.w#~.w..
007690:  32 26 90 32 19 90 21 60 8F 22 24 90 C9 3E 30 21    2&.2..!`."$..>0!
0076A0:  00 7E 11 00 C0 01 4A 00 ED B0 EB 01 B6 07 09 30    .~....J........0
0076B0:  04 01 4A C0 09 EB 3D 20 EC C9 21 6C 92 01 0E F4    ..J...= ..!l....
0076C0:  ED 49 01 C0 F6 ED 49 AF ED 79 01 92 F7 ED 49 0E    .I....I..y....I.
0076D0:  45 06 F6 ED 49 06 F4 ED 78 77 23 0C 79 FE 49 20    E...I...xw#.y.I 
0076E0:  F0 01 82 F7 ED 49 01 00 F6 ED 49 C9 00 00 00 00    .....I....I.....
0076F0:  F3 01 01 BC ED 49 01 28 BD ED 49 01 02 BC ED 49    .....I.(..I....I
007700:  01 2E BD ED 49 01 06 BC ED 49 01 19 BD ED 49 01    ....I....I....I.
007710:  07 BC ED 49 01 1E BD ED 49 01 05 BC ED 49 01 00    ...I....I....I..
007720:  BD ED 49 2A 27 90 22 38 00 08 F1 08 21 00 C0 11    ..I*'."8....!...
007730:  01 C0 01 FF 3F 75 ED B0 FB CD A7 BC C9 E1 06 2F    ....?u........./
007740:  10 FE 3E 12 1E 0D 01 01 7F DD 21 1A 90 ED 49 08    ..>.......!...I.
007750:  DD 7E 00 ED 79 00 00 00 7B 3D 20 FD DD 7E 01 ED    .~..y...{= ..~..
007760:  79 00 00 00 7B 3D 20 FD DD 7E 02 ED 79 00 00 00    y...{= ..~..y...
007770:  7B 3D 20 FD DD 7E 03 ED 79 00 00 00 7B 3D 20 FD    {= ..~..y...{= .
007780:  DD 7E 04 ED 79 00 00 00 7B 3D 20 FD DD 7E 05 ED    .~..y...{= ..~..
007790:  79 00 00 00 7B 3D 20 FD DD 7E 06 ED 79 00 00 00    y...{= ..~..y...
0077A0:  7B 3D 20 FD DD 7E 07 ED 79 7B 3D 3D 20 FD 08 3D    {= ..~..y{== ..=
0077B0:  20 9D 3E 54 ED 79 C3 5F 91 54 54 54 50 50 50 55     .>T.y._.TTTPPPU
0077C0:  55 55 53 53 53 49 49 49 4B 4B 4B 4B 4B 4B 49 49    UUSSSIIIKKKKKKII
0077D0:  49 53 53 53 55 55 55 50 50 50 54 54 54 00 3A 19    ISSSUUUPPPTTT.:.
0077E0:  90 FE FF 20 19 3A 26 90 A7 20 13 2A 84 93 7E A7    ... .:&.. .*..~.
0077F0:  20 04 21 39 93 7E 32 77 91 23 22 84 93 C9 3E 54     .!9.~2w.#"...>T
007800:  01 05 00 09 E5 E5 DD E1 32 4D 00 21 DF 02 4F 06    ........2M.!..O.
007810:  00 09 CD 58 01 E1 3A 4D 00 3C FE 20 20 E2 C9 3E    ...X..:M.<.  ..>
007820:  20 21 FF 02 F5 CD 06 08 F1 23 3D 20 F7 C9 DD 21     !.......#= ...!
007830:  17 02 18 04 DD 21 1B 02 2A 4E 00 7E DD 77 00 23    .....!..*N.~.w.#
007840:  7E DD 77 01 DD E5 E1 CD 06 08 C9 07 01 59 65 73    ~.w..........Yes
007850:  00 07 01 4E 6F 20 00 07 01 F3 00 07 01 20 00 07    ...No ....... ..
007860:  01 01 02 01 08 01 01 08 01 09 01 00 01 00 0B 01    ................
007870:  00 1A 01 0C 01 00 1A 01 0D 01 00 1A 01 0E 01 00    ................
007880:  1A 01 0F 01 00 1A 01 10 01 00 1A 01 11 01 00 1A    ................
007890:  01 12 01 00 1A 01 14 01 00 1A 01 15 01 00 1A 01    ................
0078A0:  16 01 00 1A 01 18 01 00 01 00 07 28 00 01 01 08    ...........(....
0078B0:  28 00 1A 01 09 28 00 1A 01 0A 28 00 1A 01 0B 28    (....(....(....(
0078C0:  00 1A 01 0C 28 00 1A 01 0D 28 00 1A 01 0E 28 00    ....(....(....(.
0078D0:  1A 01 0F 28 00 1A 01 10 28 00 1A 01 11 28 00 1A    ...(....(....(..
0078E0:  01 12 28 00 1A 01 13 28 00 1A 01 14 28 00 1A 01    ..(....(....(...
0078F0:  15 28 00 1A 01 16 28 00 1A 01 17 28 00 1A 01 01    .(....(....(....
007900:  05 01 1A 1A 1A 1A 1A 1A 1A 1A 11 14 00 00 01 00    ................
007910:  01 02 03 04 05 06 07 07 09 0A 0B 0C 0D 0E 0F 01    ................
007920:  05 01 1A 1A 1A 1A 1A 1A 1A 1A 11 14 00 00 01 00    ................
007930:  01 02 03 04 05 06 07 07 09 0A 0B 0C 0D 0E 0F 07    ................
007940:  03 54 65 78 74 20 73 70 65 65 64 00 08 03 43 75    .Text speed...Cu
007950:  72 73 6F 72 20 73 70 65 65 64 00 09 03 43 75 72    rsor speed...Cur
007960:  73 6F 72 20 76 69 73 69 62 6C 65 00 0B 03 54 65    sor visible...Te
007970:  78 74 6C 69 6E 65 20 31 20 63 6F 6C 6F 72 00 0C    xtline 1 color..
007980:  03 54 65 78 74 6C 69 6E 65 20 32 20 63 6F 6C 6F    .Textline 2 colo
007990:  72 00 0D 03 54 65 78 74 6C 69 6E 65 20 33 20 63    r...Textline 3 c
0079A0:  6F 6C 6F 72 00 0E 03 54 65 78 74 6C 69 6E 65 20    olor...Textline 
0079B0:  34 20 63 6F 6C 6F 72 00 0F 03 54 65 78 74 6C 69    4 color...Textli
0079C0:  6E 65 20 35 20 63 6F 6C 6F 72 00 10 03 54 65 78    ne 5 color...Tex
0079D0:  74 6C 69 6E 65 20 36 20 63 6F 6C 6F 72 00 11 03    tline 6 color...
0079E0:  54 65 78 74 6C 69 6E 65 20 37 20 63 6F 6C 6F 72    Textline 7 color
0079F0:  00 12 03 54 65 78 74 6C 69 6E 65 20 38 20 63 6F    ...Textline 8 co
007A00:  00 52 41 4E 44 4F 4D 20 20 47 57 45 00 00 00 00    .RANDOM  GWE....
007A10:  00 00 02 00 00 00 90 00 91 00 00 00 00 00 00 00    ................
007A20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007A30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007A40:  91 00 00 98 04 77 23 64 58 8E 84 24 22 02 59 1C    .....w#dX..$".Y.
007A50:  82 72 27 1E 8F FF 1A 00 00 00 00 00 00 00 00 00    .r'.............
007A60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007A70:  00 00 00 00 00 00 E8 00 00 18 05 02 00 90 00 90    ................
007A80:  88 10 85 40 51 54 2C 1D 73 18 32 53 03 0F 78 0D    ...@QT,.s.2S..x.
007A90:  26 5F 79 87 0E 68 14 41 6A 69 06 2D 1A 4B 07 55    &_y..h.Aji.-.K.U
007AA0:  01 19 74 6B 47 3D 31 50 2E 7F 33 3E 11 60 65 86    ..tkG=1P..3>.`e.
007AB0:  8B 0A 63 35 43 7D 21 6C 8C 42 57 4D 36 67 17 5D    ..c5C}!l.BWM6g.]
007AC0:  5B 80 83 4F 13 49 7A 16 3A 30 3F 6F 37 2F 04 29    [..O.Iz.:0?o7/.)
007AD0:  70 3B 0C 7E 75 34 00 39 8A 12 4E 61 6E 38 4C 3C    p;.~u4.9..Nan8L<
007AE0:  5C 81 7B 7C 66 48 28 15 05 1F 5E 45 2A 1B 8D 0B    \.{|fH(...^E*...
007AF0:  62 89 6D 2B 52 56 4A 76 46 09 44 08 20 5A 25 71    b.m+RVJvF.D. Z%q
007B00:  77 23 64 58 8E 84 24 22 02 59 1C 82 72 27 1E 8F    w#dX..$".Y..r'..
007B10:  FF 1A 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007B20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007B30:  00 E8 00 00 18 05 02 00 90 00 90 00 52 41 4E 44    ............RAND
007B40:  4F 4D 20 20 47 57 45 00 00 00 00 00 00 02 00 00    OM  GWE.........
007B50:  00 90 00 91 00 00 00 00 00 00 00 00 00 00 00 00    ................
007B60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007B70:  00 00 00 00 00 00 00 00 00 00 00 91 00 00 98 04    ................
007B80:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
007B90:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
007BA0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
007BB0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
007BC0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
007BD0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
007BE0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
007BF0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
007C00:  00 4D 4F 55 54 48 20 20 20 47 57 45 00 00 00 00    .MOUTH   GWE....
007C10:  00 00 02 00 00 00 90 00 91 00 00 00 00 00 00 00    ................
007C20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007C30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007C40:  91 00 00 84 04 07 88 06 89 05 8A 04 8B 03 8C 02    ................
007C50:  8D 01 8E 00 8F FF 1A 2E 67 77 65 22 2C 0D 00 00    ........gwe",...
007C60:  E2 2C 1C 00 90 2C 1C 91 00 00 00 00 1A 61 2E 67    .,...,.......a.g
007C70:  77 65 22 2C 0D 00 00 E2 2C 1C 00 90 2C 1C 91 00    we",....,...,...
007C80:  47 48 46 49 45 4A 44 4B 43 4C 42 4D 41 4E 40 4F    GHFIEJDKCLBMAN@O
007C90:  3F 50 3E 51 3D 52 3C 53 3B 54 3A 55 39 56 38 57    ?P>Q=R<S;T:U9V8W
007CA0:  37 58 36 59 35 5A 34 5B 33 5C 32 5D 31 5E 30 5F    7X6Y5Z4[3\2]1^0_
007CB0:  2F 60 2E 61 2D 62 2C 63 2B 64 2A 65 29 66 28 67    /`.a-b,c+d*e)f(g
007CC0:  27 68 26 69 25 6A 24 6B 23 6C 22 6D 21 6E 20 6F    'h&i%j$k#l"m!n o
007CD0:  1F 70 1E 71 1D 72 1C 73 1B 74 1A 75 19 76 18 77    .p.q.r.s.t.u.v.w
007CE0:  17 78 16 79 15 7A 14 7B 13 7C 12 7D 11 7E 10 7F    .x.y.z.{.|.}.~..
007CF0:  0F 80 0E 81 0D 82 0C 83 0B 84 0A 85 09 86 08 87    ................
007D00:  07 88 06 89 05 8A 04 8B 03 8C 02 8D 01 8E 00 8F    ................
007D10:  FF 1A 2E 67 77 65 22 2C 0D 00 00 E2 2C 1C 00 90    ...gwe",....,...
007D20:  2C 1C 91 00 00 00 00 1A 61 2E 67 77 65 22 2C 0D    ,.......a.gwe",.
007D30:  00 00 E2 2C 1C 00 90 2C 1C 91 00 00 00 00 1A AA    ...,...,........
007D40:  55 55 55 55 AA AA AA AA 55 55 55 55 AA AA AA AA    UUUU....UUUU....
007D50:  55 55 55 55 AA AA AA AA 55 55 55 55 AA AA AA AA    UUUU....UUUU....
007D60:  55 55 55 55 AA AA AA AA 55 55 55 55 AA AA AA AA    UUUU....UUUU....
007D70:  55 55 55 55 AA AA AA AA 55 55 55 55 AA AA AA AA    UUUU....UUUU....
007D80:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
007D90:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
007DA0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
007DB0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
007DC0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
007DD0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
007DE0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
007DF0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
007E00:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007E10:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007E20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007E30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007E40:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007E50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007E60:  1A 90 01 2C 0F 00 21 00 50 00 CB 20 22 66 72 61    ...,..!.P.. "fra
007E70:  6D 65 2E 73 63 72 22 2C 0D 00 00 E2 2C 1C 00 C0    me.scr",....,...
007E80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007E90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007EA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007EB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007EC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007ED0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007EE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007EF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007F00:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007F10:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007F20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007F30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007F40:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007F50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007F60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007F70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007F80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007F90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007FA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007FB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007FC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007FD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007FE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
007FF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008000:  3A 7B 92 FE FB CA 7C 92 CD 03 60 C3 D5 90 06 04    :{....|...`.....
008010:  00 10 FD 01 10 7F 3A 03 90 ED 49 ED 79 0E 00 ED    ......:...I.y...
008020:  49 ED 79 21 F0 FF 23 7C A7 20 FB 3E 54 0E 10 ED    I.y!..#|. .>T...
008030:  49 ED 79 0E 00 ED 49 ED 79 C9 2A 26 90 7E FE FF    I.y...I.y.*&.~..
008040:  CA 18 92 23 22 26 90 21 BC C1 01 4A 00 09 D6 08    ...#"&.!...J....
008050:  30 FB C6 08 01 00 08 A7 28 04 09 3D 20 FC 0E 00    0.......(..= ...
008060:  3A 18 90 A7 28 02 0E 0F 06 08 7E A1 77 23 7E A1    :...(.....~.w#~.
008070:  77 23 7E A1 77 23 7E A1 77 23 7E A1 77 23 7E A1    w#~.w#~.w#~.w#~.
008080:  77 23 7E A1 77 23 7E A1 77 23 7E A1 77 23 10 DA    w#~.w#~.w#~.w#..
008090:  7E A1 77 23 7E A1 77 C9 AF 32 28 90 32 19 90 21    ~.w#~.w..2(.2..!
0080A0:  60 8F 22 26 90 C9 3E 30 21 00 7E 11 00 C0 01 4A    `."&..>0!.~....J
0080B0:  00 ED B0 EB 01 B6 07 09 30 04 01 4A C0 09 EB 3D    ........0..J...=
0080C0:  20 EC C9 21 7A 92 01 0E F4 ED 49 01 C0 F6 ED 49     ..!z.....I....I
0080D0:  AF ED 79 01 92 F7 ED 49 0E 45 06 F6 ED 49 06 F4    ..y....I.E...I..
0080E0:  ED 78 77 23 0E 48 06 F6 ED 49 06 F4 ED 78 77 01    .xw#.H...I...xw.
0080F0:  82 F7 ED 49 01 00 F6 ED 49 C9 00 00 F3 01 01 BC    ...I....I.......
008100:  ED 49 01 28 BD ED 49 01 02 BC ED 49 01 2E BD ED    .I.(..I....I....
008110:  49 01 06 BC ED 49 01 19 BD ED 49 01 07 BC ED 49    I....I....I....I
008120:  01 1E BD ED 49 01 05 BC ED 49 01 00 BD ED 49 2A    ....I....I....I*
008130:  29 90 22 38 00 08 F1 08 CD 97 93 CD 06 96 FB C3    )."8............
008140:  A7 BC E1 06 2F 10 FE 3E 12 1E 0D 01 01 7F DD 21    ..../..>.......!
008150:  1A 90 ED 49 08 DD 7E 00 ED 79 00 00 00 7B 3D 20    ...I..~..y...{= 
008160:  FD DD 7E 01 ED 79 00 00 00 7B 3D 20 FD DD 7E 02    ..~..y...{= ..~.
008170:  ED 79 00 00 00 7B 3D 20 FD DD 7E 03 ED 79 00 00    .y...{= ..~..y..
008180:  00 7B 3D 20 FD DD 7E 04 ED 79 00 00 00 7B 3D 20    .{= ..~..y...{= 
008190:  FD DD 7E 05 ED 79 00 00 00 7B 3D 20 FD DD 7E 06    ..~..y...{= ..~.
0081A0:  ED 79 00 00 00 7B 3D 20 FD DD 7E 07 ED 79 7B 3D    .y...{= ..~..y{=
0081B0:  3D 20 FD 08 3D 20 9D 3E 54 ED 79 C3 5D 91 54 54    = ..= .>T.y.].TT
0081C0:  54 50 50 50 55 55 55 53 53 53 49 49 49 4B 4B 4B    TPPPUUUSSSIIIKKK
0081D0:  4B 4B 4B 49 49 49 53 53 53 55 55 55 50 50 50 54    KKKIIISSSUUUPPPT
0081E0:  54 54 00 3A 24 90 A7 C8 3A 19 90 FE FF 20 19 3A    TT.:$...:.... .:
0081F0:  28 90 A7 20 13 2A 95 93 7E A7 20 04 21 3E 93 7E    (.. .*..~. .!>.~
008200:  00 53 4E 4F 57 20 20 20 20 47 57 58 00 00 00 00    .SNOW    GWX....
008210:  00 00 02 00 00 00 96 00 20 01 00 96 00 00 00 00    ........ .......
008220:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008230:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008240:  20 01 00 2D 04 36 8D 1C 11 33 48 02 32 12 65 1A     ..-.6...3H.2.e.
008250:  85 0B 42 2F 06 24 5D 3A 29 16 37 46 17 2A 64 41    ..B/.$]:).7F.*dA
008260:  51 04 77 21 00 1A 20 31 30 30 2C 36 35 0D 0A 74    Q.w!.. 100,65..t
008270:  61 62 5F 78 79 32 5F 73 74 61 72 32 20 64 62 20    ab_xy2_star2 db 
008280:  C3 07 96 C3 23 96 C9 21 50 97 11 06 C2 3E 90 73    ....#..!P....>.s
008290:  23 72 23 EB 01 00 08 09 30 04 01 4A C0 09 EB 3D    #r#.....0..J...=
0082A0:  20 ED C9 3E 0A DD 21 F7 96 16 00 08 01 50 97 DD     ..>..!......P..
0082B0:  6E 00 62 29 09 4E 23 46 DD 6E 01 5D 62 09 4E 79    n.b).N#F.n.]b.Ny
0082C0:  E6 F0 77 79 01 00 08 09 30 04 01 4A C0 09 E6 0F    ..wy....0..J....
0082D0:  1F A7 20 17 1C 7B FE 4A 20 05 AF 01 B6 FF 09 DD    .. ..{.J .......
0082E0:  77 01 23 7E E6 F0 C6 08 77 18 06 4F 7E E6 F0 81    w.#~....w..O~...
0082F0:  77 DD 7E 00 3C FE 90 20 05 7E E6 F0 77 AF DD 77    w.~.<.. .~..w..w
008300:  00 DD 23 DD 23 08 3D 20 A2 3E 0A DD 21 0B 97 16    ..#.#.= .>..!...
008310:  00 08 01 50 97 DD 6E 00 62 29 09 4E 23 46 DD 6E    ...P..n.b).N#F.n
008320:  01 5D 62 09 4E 79 E6 F0 77 79 01 00 08 09 30 04    .]b.Ny..wy....0.
008330:  01 4A C0 09 E6 0F FE 0F 28 08 A7 28 05 17 FE 10    .J......(..(....
008340:  20 16 1D 7B A7 20 06 3E 49 01 49 00 09 DD 77 01     ..{. .>I.I...w.
008350:  2B 7E E6 F0 3C 77 18 06 4F 7E E6 F0 81 77 DD 7E    +~..<w..O~...w.~
008360:  00 3C FE 90 20 05 7E E6 F0 77 AF DD 77 00 DD 23    .<.. .~..w..w..#
008370:  DD 23 08 3D 20 9B C9 0C 05 79 2D 2D 20 57 43 1F    .#.= ....y-- WC.
008380:  36 8D 1C 11 33 48 02 32 12 65 1A 85 0B 42 2F 06    6...3H.2.e...B/.
008390:  24 5D 3A 29 16 37 46 17 2A 64 41 51 04 77 21 00    $]:).7F.*dAQ.w!.
0083A0:  1A 20 31 30 30 2C 36 35 0D 0A 74 61 62 5F 78 79    . 100,65..tab_xy
0083B0:  32 5F 73 74 61 72 32 20 64 62 20 38 31 2C 34 2C    2_star2 db 81,4,
0083C0:  20 31 31 39 2C 33 33 20 0D 0A 1A 47 20 26 39 36     119,33 ...G &96
0083D0:  30 30 0D 0A 57 52 49 54 45 20 22 53 4E 4F 57 2E    00..WRITE "SNOW.
0083E0:  42 49 4E 22 0D 0A 0D 0A 62 61 73 65 5F 65 63 72    BIN"....base_ecr
0083F0:  61 6E 20 65 71 75 20 26 43 32 35 30 20 2D 20 37    an equ &C250 - 7
008400:  00 50 43 20 20 20 20 20 20 47 57 45 00 00 00 00    .PC      GWE....
008410:  00 00 02 00 00 00 70 00 91 00 00 00 00 00 00 00    ......p.........
008420:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008430:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008440:  91 00 00 CA 03 80 81 82 83 84 85 86 87 88 89 8A    ................
008450:  8B 8C 8D 8E 8F FF 1A 1A 00 00 00 00 00 00 00 00    ................
008460:  00 00 00 00 00 1A 00 00 00 00 00 00 00 00 00 00    ................
008470:  00 00 00 00 00 1A 00 00 00 00 00 00 00 00 00 00    ................
008480:  00 01 02 03 04 05 06 07 08 09 0A 0B 0C 0D 0E 0F    ................
008490:  10 11 12 13 14 15 16 17 18 19 1A 1B 1C 1D 1E 1F    ................
0084A0:  20 21 22 23 24 25 26 27 28 29 2A 2B 2C 2D 2E 2F     !"#$%&'()*+,-./
0084B0:  30 31 32 33 34 35 36 37 38 39 3A 3B 3C 3D 3E 3F    0123456789:;<=>?
0084C0:  40 41 42 43 44 45 46 47 48 49 4A 4B 4C 4D 4E 4F    @ABCDEFGHIJKLMNO
0084D0:  50 51 52 53 54 55 56 57 58 59 5A 5B 5C 5D 5E 5F    PQRSTUVWXYZ[\]^_
0084E0:  60 61 62 63 64 65 66 67 68 69 6A 6B 6C 6D 6E 6F    `abcdefghijklmno
0084F0:  70 71 72 73 74 75 76 77 78 79 7A 7B 7C 7D 7E 7F    pqrstuvwxyz{|}~.
008500:  80 81 82 83 84 85 86 87 88 89 8A 8B 8C 8D 8E 8F    ................
008510:  FF 1A 1A 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008520:  1A 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008530:  1A 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008540:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008550:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008560:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008570:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008580:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
008590:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0085A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0085B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0085C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0085D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0085E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0085F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
008600:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
008610:  07 00 01 00 02 09 4E E5 07 00 C1 02 00 00 00 02    ......N.........
008620:  07 00 C6 02 00 00 00 02 07 00 C2 02 00 00 00 02    ................
008630:  07 00 C7 02 00 00 00 02 07 00 C3 02 00 00 00 02    ................
008640:  07 00 C8 02 00 00 00 02 07 00 C4 02 00 00 00 02    ................
008650:  07 00 C9 02 00 00 00 02 07 00 C5 02 00 00 00 02    ................
008660:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008670:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008680:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008690:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0086A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0086B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0086C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0086D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0086E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0086F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008700:  6E 20 66 69 63 68 69 65 72 73 2C 20 6D 61 69 73    n fichiers, mais
008710:  20 70 72 65 6E 6E 65 6E 74 0D 70 61 73 20 6D 61     prennent.pas ma
008720:  6C 20 64 65 20 70 6C 61 63 65 20 28 31 30 38 6B    l de place (108k
008730:  6F 20 65 74 20 32 34 30 6B 6F 2C 20 6A 65 0D 63    o et 240ko, je.c
008740:  72 6F 69 73 29 2C 20 6C 65 20 64 65 72 6E 69 65    rois), le dernie
008750:  72 20 65 73 74 20 65 6E 63 6F 72 65 20 70 6C 6F    r est encore plo
008760:  6D 62 65 2E 0D 0D 50 6F 75 72 20 61 6C 69 6D 65    mbe...Pour alime
008770:  6E 74 65 72 20 20 74 61 20 42 42 53 2C 20 20 74    nter  ta BBS,  t
008780:  75 20 74 72 6F 75 76 65 72 61 73 0D 61 75 73 73    u trouveras.auss
008790:  69 20 64 65 75 78 20 75 74 69 6C 69 74 61 69 72    i deux utilitair
0087A0:  65 73 2C 20 43 68 65 65 73 65 20 31 2E 31 20 65    es, Cheese 1.1 e
0087B0:  74 0D 44 69 67 69 74 72 61 6B 65 72 20 31 2E 34    t.Digitraker 1.4
0087C0:  2E 20 4A 65 20 6E 27 61 69 20 70 61 73 20 70 75    . Je n'ai pas pu
0087D0:  20 74 65 20 6D 65 74 0D 74 72 65 20 70 6C 75 73     te met.tre plus
0087E0:  20 20 64 65 20 64 69 73 71 75 65 74 74 65 73 2C      de disquettes,
0087F0:  20 20 63 61 72 20 6A 65 20 73 75 69 73 0D 65 6E      car je suis.en
008800:  20 72 75 70 74 75 72 65 20 20 64 65 20 73 74 6F     rupture  de sto
008810:  63 6B 2C 20 6D 61 69 73 20 73 69 20 74 75 20 76    ck, mais si tu v
008820:  65 75 78 0D 64 27 61 75 74 72 65 73 20 20 70 72    eux.d'autres  pr
008830:  6F 67 72 61 6D 6D 65 73 20 28 64 65 6D 6F 73 2C    ogrammes (demos,
008840:  20 75 74 69 6C 73 20 6F 75 0D 6A 65 75 78 29 20     utils ou.jeux) 
008850:  70 6F 75 72 20 74 6F 6E 20 73 65 72 76 65 75 72    pour ton serveur
008860:  2C 20 20 6A 65 20 70 65 75 78 20 74 27 65 6E 0D    ,  je peux t'en.
008870:  70 72 6F 63 75 72 65 72 20 21 0D 0D 43 65 74 74    procurer !..Cett
008880:  65 20 70 72 65 73 65 6E 74 61 74 69 6F 6E 20 61    e presentation a
008890:  20 65 74 65 20 20 72 65 61 6C 69 73 65 65 20 61     ete  realisee a
0088A0:  2D 0D 76 65 63 20 75 6E 65 20 70 72 65 76 65 72    -.vec une prever
0088B0:  73 69 6F 6E 20 64 65 20 6D 6F 6E 20 6E 6F 75 76    sion de mon nouv
0088C0:  65 6C 20 75 74 69 2D 0D 6C 69 74 61 69 72 65 2C    el uti-.litaire,
0088D0:  20 47 68 6F 75 6C 27 73 20 57 72 69 74 65 72 2E     Ghoul's Writer.
0088E0:  20 53 69 20 74 75 20 65 73 20 69 6E 2D 0D 74 65     Si tu es in-.te
0088F0:  72 65 73 73 65 2C 20 20 6A 65 20 74 27 65 6E 20    resse,  je t'en 
008900:  00 55 50 44 4F 57 4E 32 20 42 49 4E 00 00 00 00    .UPDOWN2 BIN....
008910:  00 00 02 00 00 00 90 00 91 00 00 00 00 00 00 00    ................
008920:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008930:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008940:  91 00 00 BC 04 40 4F 41 4E 42 4D 43 4C 44 4B 45    .....@OANBMCLDKE
008950:  4A 46 49 47 48 FF 1A 00 00 00 00 00 00 00 00 00    JFIGH...........
008960:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008970:  00 00 00 00 00 00 BA 00 00 E5 04 02 70 01 70 01    ............p.p.
008980:  00 8F 01 8E 02 8D 03 8C 04 8B 05 8A 06 89 07 88    ................
008990:  08 87 09 86 0A 85 0B 84 0C 83 0D 82 0E 81 0F 80    ................
0089A0:  10 7F 11 7E 12 7D 13 7C 14 7B 15 7A 16 79 17 78    ...~.}.|.{.z.y.x
0089B0:  18 77 19 76 1A 75 1B 74 1C 73 1D 72 1E 71 1F 70    .w.v.u.t.s.r.q.p
0089C0:  20 6F 21 6E 22 6D 23 6C 24 6B 25 6A 26 69 27 68     o!n"m#l$k%j&i'h
0089D0:  28 67 29 66 2A 65 2B 64 2C 63 2D 62 2E 61 2F 60    (g)f*e+d,c-b.a/`
0089E0:  30 5F 31 5E 32 5D 33 5C 34 5B 35 5A 36 59 37 58    0_1^2]3\4[5Z6Y7X
0089F0:  38 57 39 56 3A 55 3B 54 3C 53 3D 52 3E 51 3F 50    8W9V:U;T<S=R>Q?P
008A00:  40 4F 41 4E 42 4D 43 4C 44 4B 45 4A 46 49 47 48    @OANBMCLDKEJFIGH
008A10:  FF 1A 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008A20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008A30:  00 BA 00 00 E5 04 02 70 01 70 01 00 55 50 2D 44    .......p.p..UP-D
008A40:  4F 57 4E 32 42 41 53 00 00 00 00 00 00 00 00 00    OWN2BAS.........
008A50:  70 01 00 B7 00 00 00 00 00 00 00 00 00 00 00 00    p...............
008A60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008A70:  00 00 00 00 00 00 00 00 00 00 00 B7 00 00 F1 04    ................
008A80:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
008A90:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
008AA0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
008AB0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
008AC0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
008AD0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
008AE0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
008AF0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
008B00:  00 53 55 42 4D 41 52 49 4E 47 57 58 00 00 00 00    .SUBMARINGWX....
008B10:  00 00 02 00 00 00 96 00 F0 06 00 00 00 00 00 00    ................
008B20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008B30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008B40:  F0 06 00 DB 05 00 00 00 00 00 00 00 00 00 06 00    ................
008B50:  00 00 00 00 00 02 00 00 00 00 00 00 02 00 00 00    ................
008B60:  00 00 00 02 00 00 00 00 00 00 07 00 00 00 00 00    ................
008B70:  00 07 08 00 00 00 00 00 07 0C 00 00 00 07 0F 08    ................
008B80:  C3 07 96 C3 40 96 C9 21 4E 97 11 06 C2 3E 90 73    ....@..!N....>.s
008B90:  23 72 23 EB 01 00 08 09 30 04 01 4A C0 09 EB 3D    #r#.....0..J...=
008BA0:  20 ED 21 06 C2 22 4B 97 3E 01 32 49 97 AF 32 4A     .!.."K.>.2I..2J
008BB0:  97 32 47 97 32 48 97 3E 3C 32 80 96 32 4D 97 C9    .2G.2H.><2..2M..
008BC0:  3A 4D 97 A7 28 05 3D 32 4D 97 C9 2A 4B 97 11 0D    :M..(.=2M..*K...
008BD0:  F0 01 FA 07 7E A2 77 23 7E A2 77 23 7E A2 77 23    ....~.w#~.w#~.w#
008BE0:  7E A2 77 23 7E A2 77 23 7E A2 77 23 7E A2 77 09    ~.w#~.w#~.w#~.w.
008BF0:  30 07 01 4A C0 09 01 FA 07 1D 7B 20 D7 3A 4A 97    0..J......{ .:J.
008C00:  3C 20 08 3E 3C 32 80 96 AF 18 0B FE 83 20 07 3E    < .><2....... .>
008C10:  3D 32 80 96 3E 83 32 4A 97 01 4E 97 26 00 6F 29    =2..>.2J..N.&.o)
008C20:  09 4E 23 46 3A 47 97 A7 20 36 3E 01 32 47 97 C5    .N#F:G.. 6>.2G..
008C30:  3A 48 97 FE 0C 20 01 AF 3C 32 48 97 21 43 98 01    :H... ..<2H.!C..
008C40:  5B 00 09 3D 20 FC E5 DD E1 C1 3A 49 97 3D 20 0B    [..= .....:I.= .
008C50:  3E 43 32 49 97 3E 80 32 4D 97 C9 32 49 97 18 1F    >C2I.>.2M..2I...
008C60:  AF 32 47 97 C5 3A 48 97 3C 32 48 97 21 43 98 01    .2G..:H.<2H.!C..
008C70:  5B 00 09 3D 20 FC E5 DD E1 C1 3A 49 97 18 00 6F    [..= .....:I...o
008C80:  26 00 09 22 4B 97 3E 0D 01 FA 07 ED 73 45 97 DD    &.."K.>.....sE..
008C90:  F9 08 D1 7E 83 77 23 7E 82 77 D1 23 7E 83 77 23    ...~.w#~.w.#~.w#
008CA0:  7E 82 77 D1 23 7E 83 77 23 7E 82 77 D1 23 7E 83    ~.w.#~.w#~.w.#~.
008CB0:  77 3B 09 30 07 01 4A C0 09 01 FA 07 08 3D 20 D1    w;.0..J......= .
008CC0:  ED 7B 45 97 C9 00 00 00 00 00 00 00 C0 00 00 00    .{E.............
008CD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008CE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008CF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008D00:  01 46 69 6C 65 20 73 61 76 65 64 20 73 75 63 63    .File saved succ
008D10:  65 73 66 75 6C 6C 79 2E 00 07 01 4E 6F 20 74 65    esfully....No te
008D20:  78 74 20 74 6F 20 73 61 76 65 2E 2E 2E 00 07 01    xt to save......
008D30:  45 72 72 6F 72 2E 2E 2E 20 46 69 6C 65 20 68 61    Error... File ha
008D40:  73 20 6E 6F 20 6E 61 6D 65 2E 00 21 FF 5F 01 0B    s no name..!._..
008D50:  4E 7E FE 20 20 08 2B 0B 78 FE FF C8 18 F3 03 69    N~.  .+.x......i
008D60:  60 C9 21 F2 91 7E A7 C8 23 46 23 E5 CD 27 BB E1    `.!..~..#F#..'..
008D70:  18 F3 0F 81 0D 82 0E 83 05 84 14 85 0C 86 04 87    ................
008D80:  0A 88 0B 89 03 8A 07 2E 00 AF 32 00 A7 CD 1E 92    ..........2.....
008D90:  C3 86 8A 3E 01 32 00 A7 CD 1E 92 C3 86 8A 21 3C    ...>.2........!<
008DA0:  8A 3A 00 A7 C6 41 32 47 8A CD 9A 88 C9 06 6B 21    .:...A2G......k!
008DB0:  00 98 11 58 9B C5 06 08 AF 4E CB 61 28 02 3E 03    ...X.....N.a(.>.
008DC0:  CB 69 28 02 C6 0C CB 71 28 02 C6 30 CB 79 28 02    .i(....q(..0.y(.
008DD0:  C6 C0 12 13 AF CB 41 28 02 C6 03 CB 49 28 02 C6    ......A(....I(..
008DE0:  0C CB 51 28 02 C6 30 CB 59 28 02 C6 C0 12 13 23    ..Q(..0.Y(.....#
008DF0:  10 C6 C1 10 C0 C9 00 00 00 00 00 00 00 00 00 00    ................
008E00:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008E10:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008E20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008E30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008E40:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008E50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008E60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008E70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008E80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008E90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008EA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008EB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008EC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008ED0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008EE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008EF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008F00:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008F10:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008F20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008F30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008F40:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008F50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008F60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008F70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008F80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008F90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008FA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008FB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008FC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008FD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008FE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
008FF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
009000:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
009010:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
009020:  01 08 00 00 00 00 00 00 08 00 00 00 00 00 00 08    ................
009030:  00 00 00 00 00 00 08 00 00 00 00 00 01 0C 00 00    ................
009040:  00 00 00 01 0E 00 00 00 00 00 01 0F 00 00 07 01    ................
009050:  0F 0E 00 0F 0C 07 03 0F 0F 0F 0F 0F 08 03 0F 0F    ................
009060:  0F 0F 0F 0F 03 0F 0F 0F 0F 0F 08 01 0F 0F 0F 0F    ................
009070:  0C 07 00 00 00 00 00 00 07 00 00 06 00 00 00 00    ................
009080:  00 00 02 00 00 00 00 00 00 02 00 00 00 00 00 00    ................
009090:  02 00 00 00 00 00 00 07 00 00 00 00 00 00 07 08    ................
0090A0:  00 00 00 00 00 07 0C 00 01 0C 07 0F 08 03 0F 01    ................
0090B0:  0C 0F 0F 0F 0F 0F 0E 00 0F 0F 0F 0F 0F 0F 0C 0F    ................
0090C0:  0F 0F 0F 0F 0E 00 07 0F 0F 0F 0F 01 0C 00 00 00    ................
0090D0:  00 00 01 0C 00 00 00 00 00 00 00 00 00 01 08 00    ................
0090E0:  00 00 00 00 00 08 00 00 00 00 00 00 08 00 00 00    ................
0090F0:  00 00 01 0C 00 00 00 00 00 01 0E 00 00 00 00 00    ................
009100:  00 2D 47 57 2D 53 54 20 20 42 41 53 00 00 00 00    .-GW-ST  BAS....
009110:  00 00 00 00 00 70 01 00 6C 12 00 00 00 00 00 00    .....p..l.......
009120:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
009130:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
009140:  6C 12 00 22 04 28 FF 73 28 0D 00 00 6C 6F 6E E7    l..".(.s(...lon.
009150:  2C 12 29 2C 11 2C 10 29 29 01 BE 20 1C 88 BE 2C    ,.),.,.)).. ...,
009160:  FF 1D 28 22 26 22 F4 AC 28 FF 73 28 0D 00 00 6C    ..("&"..(.s(...l
009170:  6F 6E E7 2C 12 29 2C 0F 2C 10 29 29 01 83 20 1C    on.,.),.,.)).. .
009180:  34 00 01 00 01 C0 20 53 6F 75 6E 64 74 72 61 6B    4..... Soundtrak
009190:  6B 65 72 20 63 6F 6D 70 69 6C 65 64 20 6D 75 73    ker compiled mus
0091A0:  69 63 73 20 72 65 6C 6F 63 61 74 6F 72 20 76 20    ics relocator v 
0091B0:  31 2E 30 00 08 00 02 00 01 C0 20 00 24 00 03 00    1.0....... .$...
0091C0:  01 C0 20 54 6F 6D 20 65 74 20 4A 65 72 72 79 20    .. Tom et Jerry 
0091D0:  6F 66 20 47 50 41 20 28 63 29 20 31 39 39 34 00    of GPA (c) 1994.
0091E0:  07 00 04 00 01 C0 00 1E 00 05 00 01 C0 20 52 65    ............. Re
0091F0:  76 69 73 69 6F 6E 20 64 75 20 32 33 2F 30 38 2F    vision du 23/08/
009200:  39 34 20 21 00 07 00 06 00 01 C0 00 1F 00 0A 00    94 !............
009210:  83 20 1C 4E BB 01 82 20 0E 01 A2 20 0E 2C 0E 01    . .N... ... .,..
009220:  A2 20 0F 2C 19 1A 01 AD 20 10 00 52 00 14 00 BF    . .,.... ..R....
009230:  20 22 47 68 6F 75 6C 27 73 20 57 72 69 74 65 72     "Ghoul's Writer
009240:  20 53 6F 75 6E 64 74 72 61 6B 6B 65 72 20 72 65     Soundtrakker re
009250:  6C 6F 63 61 74 6F 72 20 76 31 2E 30 20 20 54 6F    locator v1.0  To
009260:  6D 20 65 74 20 4A 65 72 72 79 20 6F 66 20 47 50    m et Jerry of GP
009270:  41 20 28 63 29 20 31 39 39 34 20 22 00 11 00 1E    A (c) 1994 "....
009280:  00 BF 20 FF 7B 28 19 50 2C 22 5F 22 29 00 10 00    .. .{(.P,"_")...
009290:  28 00 D8 20 0F 2C 19 50 2C 12 2C 19 19 00 08 00    (.. .,.P,.,.....
0092A0:  32 00 01 C0 20 00 1C 00 3C 00 01 C0 20 56 61 72    2... ...<... Var
0092B0:  69 61 62 6C 65 73 20 64 65 20 74 72 61 76 61 69    iables de travai
0092C0:  6C 00 07 00 46 00 01 C0 00 12 00 50 00 0D 00 00    l...F......P....
0092D0:  62 61 73 E5 20 EF 20 1C 00 40 00 18 00 5A 00 0D    bas. . ..@...Z..
0092E0:  00 00 61 64 F2 20 EF 20 0E 01 0D 00 00 61 64 B1    ..ad. . .....ad.
0092F0:  EF 0E 00 15 00 64 00 0D 00 00 67 77 73 74 61 72    .....d....gwstar
009300:  01 0F 00 00 00 01 0F 0E 00 0F 0C 07 03 0F 0F 0F    ................
009310:  0F 0F 08 03 0F 0F 0F 0F 0F 0F 03 0F 0F 0F 0F 0F    ................
009320:  08 01 0F 0F 0F 0F 0C 07 00 00 00 00 00 00 00 00    ................
009330:  00 00 00 00 00 00 00 00 06 00 00 00 00 00 00 02    ................
009340:  00 00 00 00 00 00 02 00 00 00 00 00 00 07 00 00    ................
009350:  00 00 00 00 07 08 00 00 00 00 00 07 0C 00 00 00    ................
009360:  07 0F 08 03 0F 01 0C 0F 0F 0F 0F 0F 0E 00 0F 0F    ................
009370:  0F 0F 0F 0F 0C 0F 0F 0F 0F 0F 0E 00 07 0F 0F 0F    ................
009380:  0F 01 0C 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
009390:  00 00 00 00 00 00 00 00 00 00 01 08 00 00 00 00    ................
0093A0:  00 00 08 00 00 00 00 00 01 0C 00 00 00 00 00 01    ................
0093B0:  0E 00 00 00 00 00 01 0F 00 00 00 01 0F 0E 00 0F    ................
0093C0:  0C 00 03 0F 0F 0F 0F 0F 0F 03 0F 0F 0F 0F 0F 00    ................
0093D0:  03 0F 0F 0F 0F 0F 0F 01 0F 0F 0F 0F 0C 00 00 00    ................
0093E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0093F0:  00 00 00 00 00 06 00 00 00 00 00 00 02 00 00 00    ................
009400:  00 00 00 07 00 00 00 00 00 00 07 08 00 00 00 00    ................
009410:  00 07 0C 00 00 00 07 0F 08 03 0F 00 00 0F 0F 0F    ................
009420:  0F 0F 0F 0C 0F 0F 0F 0F 0F 0C 00 0F 0F 0F 0F 0F    ................
009430:  0F 0C 07 0F 0F 0F 0F 00 00 00 00 00 00 00 00 00    ................
009440:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
009450:  01 08 00 00 00 00 00 00 08 00 00 00 00 00 01 0C    ................
009460:  00 00 00 00 00 01 0E 00 00 00 00 00 01 0F 00 00    ................
009470:  00 01 0F 0E 00 0F 0C 00 03 0F 0F 0F 0F 0F 08 03    ................
009480:  0F 0F 0F 0F 0F 0F 03 0F 0F 0F 0F 0F 08 01 0F 0F    ................
009490:  0F 0F 0C 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0094A0:  00 00 00 00 00 00 00 00 00 00 00 06 00 00 00 00    ................
0094B0:  00 00 02 00 00 00 00 00 00 07 00 00 00 00 00 00    ................
0094C0:  07 08 00 00 00 00 00 07 0C 00 00 00 07 0F 08 03    ................
0094D0:  0F 00 00 0F 0F 0F 0F 0F 0E 00 0F 0F 0F 0F 0F 0F    ................
0094E0:  0C 0F 0F 0F 0F 0F 0E 00 07 0F 0F 0F 0F 00 00 00    ................
0094F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 01    ................
009500:  F4 20 EF 20 1C 00 60 00 14 00 6E 00 0D 00 00 67    . . ..`...n....g
009510:  77 6C 6F 6E E7 20 EF 20 1C 00 1D 00 17 00 78 00    wlon. . ......x.
009520:  03 00 00 EB EF 22 22 01 03 00 00 6D 61 72 EB EF    .....""....mar..
009530:  22 22 00 1E 00 82 00 0D 00 00 64 61 74 61 64 F2    ""........datad.
009540:  EF 0E 01 0D 00 00 66 69 6E 74 61 62 6C E5 EF 0E    ......fintabl...
009550:  00 08 00 8C 00 01 C0 20 00 14 00 96 00 01 C0 20    ....... ....... 
009560:  6C 6F 61 64 20 53 74 20 66 69 6C 65 00 07 00 A0    load St file....
009570:  00 01 C0 00 48 00 AA 00 A3 20 22 4E 61 6D 65 20    ....H...£ "Name 
009580:  6F 66 20 74 68 65 20 53 2E 54 20 66 69 6C 65 20    of the S.T file 
009590:  74 6F 20 6C 6F 61 64 20 28 45 6E 74 65 72 20 3D    to load (Enter =
0095A0:  20 44 69 72 65 63 74 6F 72 79 29 20 3A 20 22 2C     Directory) : ",
0095B0:  03 00 00 6C 6F 61 64 6E 61 6D E5 00 2B 00 B4 00    ...loadnam..+...
0095C0:  A1 20 03 00 00 6C 6F 61 64 6E 61 6D E5 EF 22 22    . ...loadnam..""
0095D0:  20 EB 20 A9 20 0F 2C 10 01 84 01 A9 20 0F 2C 0F     . . .,..... .,.
0095E0:  01 A0 20 1E AA 00 00 15 00 BE 00 B7 22 64 22 01    .. ........."d".
0095F0:  AA 20 1C FF 3F 01 9F 20 1E 3E 03 00 3A 00 C8 00    . ..?.. .>..:...
009600:  D8 20 0F 2C 19 50 2C 13 2C 19 19 01 8A 01 D8 20    . .,.P,.,...... 
009610:  0F 2C 19 50 2C 11 2C 19 19 01 A8 20 03 00 00 6C    .,.P,.,.... ...l
009620:  6F 61 64 6E 61 6D E5 2C 0D 00 00 62 61 73 E5 01    oadnam.,...bas..
009630:  A9 20 0F 2C 11 00 07 00 D2 00 01 C0 00 26 00 DC    . .,.........&..
009640:  00 01 C0 20 54 65 73 74 20 66 69 6C 65 20 28 69    ... Test file (i
009650:  73 20 69 74 20 61 6E 20 53 54 20 66 69 6C 65 20    s it an ST file 
009660:  3F 29 00 07 00 E6 00 01 C0 00 51 00 F0 00 03 00    ?)........Q.....
009670:  00 6D 61 72 EB EF 22 22 01 9E 20 0D 00 00 E9 EF    .mar.."".. .....
009680:  0D 00 00 62 61 73 E5 20 F4 20 1C 5C 04 20 EC 20    ...bas. . .\. . 
009690:  0D 00 00 62 61 73 E5 F4 1C 64 04 01 03 00 00 6D    ...bas...d.....m
0096A0:  61 72 EB EF 03 00 00 6D 61 72 EB F4 FF 03 28 FF    ar.....mar....(.
0096B0:  12 28 0D 00 00 E9 29 29 01 B0 00 7C 00 FA 00 A1    .(....))...|....
0096C0:  20 03 00 00 6D 61 72 EB EF 22 53 54 2D 4D 6F 64     ...mar.."ST-Mod
0096D0:  75 6C 65 22 20 EB 20 BF 01 BF 20 22 46 69 6C 65    ule" . ... "File
0096E0:  20 69 73 20 61 20 53 6F 75 6E 64 74 72 61 6B 6B     is a Soundtrakk
0096F0:  65 72 20 49 6E 74 65 72 72 75 70 74 20 6D 6F 64    er Interrupt mod
009700:  08 00 00 00 00 00 00 08 00 00 00 00 00 00 08 00    ................
009710:  00 00 00 00 01 0C 00 00 00 00 00 01 0E 00 00 00    ................
009720:  00 00 01 0F 00 00 00 01 0F 0E 00 0F 0C 00 03 0F    ................
009730:  0F 0F 0F 0F 0F 03 0F 0F 0F 0F 0F 08 03 0F 0F 0F    ................
009740:  0F 0F 0F 01 0F 0F 0F 0F 0C 00 00 00 00 00 00 00    ................
009750:  00 00 00 00 00 00 00 00 00 00 06 00 00 00 00 00    ................
009760:  00 02 00 00 00 00 00 00 02 00 00 00 00 00 00 07    ................
009770:  00 00 00 00 00 00 07 08 00 00 00 00 00 07 0C 00    ................
009780:  00 00 07 0F 08 03 0F 00 00 0F 0F 0F 0F 0F 0F 0C    ................
009790:  0F 0F 0F 0F 0F 0E 00 0F 0F 0F 0F 0F 0F 0C 07 0F    ................
0097A0:  0F 0F 0F 00 00 00 00 00 00 00 00 00 00 00 01 08    ................
0097B0:  00 00 00 00 00 00 08 00 00 00 00 00 00 08 00 00    ................
0097C0:  00 00 00 00 08 00 00 00 00 00 01 0C 00 00 00 00    ................
0097D0:  00 01 0E 00 00 00 00 00 01 0F 00 00 00 01 0F 0E    ................
0097E0:  00 0F 0C 07 03 0F 0F 0F 0F 0F 08 03 0F 0F 0F 0F    ................
0097F0:  0F 0F 03 0F 0F 0F 0F 0F 08 01 0F 0F 0F 0F 0C 07    ................
009800:  00 00 00 00 00 00 00 00 00 06 00 00 00 00 00 00    ................
009810:  02 00 00 00 00 00 00 02 00 00 00 00 00 00 02 00    ................
009820:  00 00 00 00 00 07 00 00 00 00 00 00 07 08 00 00    ................
009830:  00 00 00 07 0C 00 00 00 07 0F 08 03 0F 01 0C 0F    ................
009840:  0F 0F 0F 0F 0E 00 0F 0F 0F 0F 0F 0F 0C 0F 0F 0F    ................
009850:  0F 0F 0E 00 07 0F 0F 0F 0F 01 0C 00 00 00 00 00    ................
009860:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
009870:  1A 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
009880:  0F 0F 0F 0F 0F 0F 03 0F 0F 0F 0F 0F 08 01 0F 0F    ................
009890:  0F 0F 0C 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0098A0:  00 00 00 00 00 00 00 00 00 00 00 06 00 00 00 00    ................
0098B0:  00 00 02 00 00 00 00 00 00 07 00 00 00 00 00 00    ................
0098C0:  07 08 00 00 00 00 00 07 0C 00 00 00 07 0F 08 03    ................
0098D0:  0F 00 00 0F 0F 0F 0F 0F 0E 00 0F 0F 0F 0F 0F 0F    ................
0098E0:  0C 0F 0F 0F 0F 0F 0E 00 07 0F 0F 0F 0F 00 00 00    ................
0098F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 01    ................
009900:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
009910:  08 00 01 00 02 09 4E E5 08 00 C1 02 00 00 00 02    ......N.........
009920:  08 00 C6 02 00 00 00 02 08 00 C2 02 00 00 00 02    ................
009930:  08 00 C7 02 00 00 00 02 08 00 C3 02 00 00 00 02    ................
009940:  08 00 C8 02 00 00 00 02 08 00 C4 02 00 00 00 02    ................
009950:  08 00 C9 02 00 00 00 02 08 00 C5 02 00 00 00 02    ................
009960:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
009970:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
009980:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
009990:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0099A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0099B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0099C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0099D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0099E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0099F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
009A00:  75 6C 65 2E 20 43 68 61 6E 67 69 6E 67 20 69 74    ule. Changing it
009A10:  20 69 6E 74 6F 20 69 6E 20 61 20 52 61 77 20 6D     into in a Raw m
009A20:  6F 64 75 6C 65 2E 2E 2E 20 22 01 9F 20 1E CE 04    odule... ".. ...
009A30:  01 A0 20 1E 40 01 00 51 00 04 01 03 00 00 6D 61    .. .@..Q......ma
009A40:  72 EB EF 22 22 01 9E 20 0D 00 00 E9 EF 0D 00 00    r.."".. ........
009A50:  62 61 73 E5 20 F4 20 1C 38 04 20 EC 20 0D 00 00    bas. . .8. . ...
009A60:  62 61 73 E5 F4 1C 40 04 01 03 00 00 6D 61 72 EB    bas...@.....mar.
009A70:  EF 03 00 00 6D 61 72 EB F4 FF 03 28 FF 12 28 0D    ....mar....(..(.
009A80:  00 00 E9 29 29 01 B0 00 5C 00 0E 01 A1 20 03 00    ...))...\.... ..
009A90:  00 6D 61 72 EB F2 22 53 54 2D 4D 6F 64 75 6C 65    .mar.."ST-Module
009AA0:  22 20 EB 20 BF 01 BF 20 22 46 69 6C 65 20 6D 61    " . ... "File ma
009AB0:  79 20 6E 6F 74 20 62 65 20 61 20 53 6F 75 6E 64    y not be a Sound
009AC0:  74 72 61 6B 6B 65 72 20 63 6F 6D 70 69 6C 65 64    trakker compiled
009AD0:  20 6D 75 73 69 63 2E 2E 2E 22 20 01 97 20 A0 20     music..." .. . 
009AE0:  1E 40 01 00 5C 00 18 01 BF 01 BF 20 22 44 6F 20    .@..\...... "Do 
009AF0:  77 65 20 63 6F 6E 74 69 6E 75 65 20 28 59 2F 4E    we continue (Y/N
009B00:  29 22 01 03 00 00 EB EF 22 22 01 D6 20 03 00 00    )"......"".. ...
009B10:  EB F2 22 59 22 20 FA 20 03 00 00 EB F2 22 4E 22    .."Y" . ....."N"
009B20:  01 03 00 00 EB EF FF 1C 28 FF 43 29 01 D5 01 A1    ........(.C)....
009B30:  20 03 00 00 EB EF 22 4E 22 20 EB 20 BF 01 98 00     ....."N" . ....
009B40:  07 00 22 01 01 C0 00 17 00 2C 01 01 C0 20 43 6F    .."......,... Co
009B50:  6E 76 65 72 74 20 53 74 20 66 69 6C 65 00 07 00    nvert St file...
009B60:  36 01 01 C0 00 30 00 40 01 0D 00 00 6F 6C 64 73    6....0.@....olds
009B70:  74 61 72 F4 20 EF 20 FF 12 28 1C 01 40 29 20 F4    tar. . ..(..@) .
009B80:  20 28 FF 12 28 1C 02 40 29 F6 1A 00 01 29 20 F5     (..(..@)....) .
009B90:  20 1C 0B 00 00 3D 00 4A 01 BF 01 A3 20 22 4E 65     ....=.J...£ "Ne
009BA0:  77 20 73 74 61 72 74 20 61 64 72 65 73 73 20 28    w start adress (
009BB0:  48 65 78 61 29 20 20 20 20 20 20 20 20 20 20 20    Hexa)           
009BC0:  20 20 20 20 3A 20 26 22 2C 03 00 00 73 74 61 72        : &",...star
009BD0:  F4 00 4A 00 54 01 0D 00 00 73 74 61 72 F4 EF FF    ..J.T....star...
009BE0:  1D 28 22 26 22 F4 03 00 00 73 74 61 72 F4 29 01    .("&"....star.).
009BF0:  A1 20 0D 00 00 73 74 61 72 F4 F1 0E 20 EB 20 0D    . ...star... . .
009C00:  0A 00 B6 03 9F 20 1E 6A 04 00 96 00 C0 03 0D 00    ..... .j........
009C10:  00 61 64 B1 EF FF 12 28 0D 00 00 64 61 74 61 64    .ad....(...datad
009C20:  F2 29 F4 FF 12 28 0D 00 00 64 61 74 61 64 F2 F4    .)...(...datad..
009C30:  0F 29 F6 1A 00 01 01 0D 00 00 61 64 B1 EF 0D 00    .)........ad....
009C40:  00 61 64 B1 F4 0D 00 00 64 65 63 61 EC 01 BE 20    .ad.....deca... 
009C50:  0D 00 00 64 61 74 61 64 F2 2C FF 1D 28 22 26 22    ...datad.,..("&"
009C60:  F4 AC 28 FF 73 28 0D 00 00 61 64 B1 2C 12 29 2C    ..(.s(...ad.,.),
009C70:  11 2C 10 29 29 01 BE 20 0D 00 00 64 61 74 61 64    .,.)).. ...datad
009C80:  F2 F4 0F 2C FF 1D 28 22 26 22 F4 AC 28 FF 73 28    ...,..("&"..(.s(
009C90:  0D 00 00 61 64 B1 2C 12 29 2C 0F 2C 10 29 29 00    ...ad.,.),.,.)).
009CA0:  3A 00 CA 03 0D 00 00 64 61 74 61 64 F2 EF 0D 00    :......datad....
009CB0:  00 64 61 74 61 64 F2 20 F4 20 11 01 A1 20 0D 00    .datad. . ... ..
009CC0:  00 64 61 74 61 64 F2 20 F0 20 0D 00 00 66 69 6E    .datad. . ...fin
009CD0:  74 61 62 6C E5 20 EB 20 C9 00 0A 00 D4 03 A0 20    tabl. . ....... 
009CE0:  1E C0 03 00 08 00 DE 03 01 C0 20 00 20 00 E8 03    .......... . ...
009CF0:  01 C0 20 43 68 61 6E 67 65 20 70 61 74 74 65 72    .. Change patter
009D00:  6E 73 20 61 64 72 65 73 73 65 73 00 07 00 F2 03    ns adresses.....
009D10:  01 C0 00 36 00 FC 03 A1 20 0D 00 00 6C 6F 6E E7    ...6.... ...lon.
009D20:  20 EE 20 0D 00 00 67 77 6C 6F 6E E7 20 EB 20 BF     . ...gwlon. . .
009D30:  20 22 46 69 6C 65 20 69 73 20 74 6F 6F 20 6C 6F     "File is too lo
009D40:  6E 67 2E 2E 2E 22 01 98 00 38 00 06 04 C7 20 1E    ng..."...8.... .
009D50:  42 04 01 9E 20 0D 00 00 E9 EF 1C 80 BE 20 EC 20    B... ........ . 
009D60:  1C 8B BE 01 C3 20 03 00 00 E1 01 BE 20 0D 00 00    ..... ...... ...
009D70:  E9 2C FF 1D 28 22 26 22 F4 03 00 00 E1 29 01 B0    .,..("&".....)..
009D80:  00 1F 00 10 04 9E 20 0D 00 00 E9 EF 0F 20 EC 20    ...... ...... . 
009D90:  FF 0E 28 03 00 00 73 61 76 65 6E 61 6D E5 29 00    ..(...savenam.).
009DA0:  4D 00 1A 04 A1 20 AC 28 03 00 00 73 61 76 65 6E    M.... .(...saven
009DB0:  61 6D E5 2C 0D 00 00 E9 2C 0F 29 20 EF 20 22 2E    am.,....,.) . ".
009DC0:  22 20 EB 20 03 00 00 73 61 76 65 6E 61 6D E5 EF    " . ...savenam..
009DD0:  FF 75 28 03 00 00 73 61 76 65 6E 61 6D E5 2C 0D    .u(...savenam.,.
009DE0:  00 00 E9 F5 0F 29 01 A0 20 1E 2E 04 00 06 00 24    .....).. ......$
009DF0:  04 B0 00 23 00 2E 04 03 00 00 73 61 76 65 6E 61    ...#......savena
009E00:  00 00 73 74 61 72 F4 20 EF 20 0D 00 00 73 74 61    ..star. . ...sta
009E10:  72 F4 20 F4 20 1F 00 00 00 00 91 00 24 00 5E 01    r. . .......$.^.
009E20:  0D 00 00 64 65 63 61 EC EF 0D 00 00 73 74 61 72    ...deca.....star
009E30:  F4 20 F5 20 0D 00 00 6F 6C 64 73 74 61 72 F4 00    . . ...oldstar..
009E40:  07 00 68 01 01 C0 00 19 00 72 01 BF 01 BF 20 22    ..h......r.... "
009E50:  50 6C 65 61 73 65 20 77 61 69 74 2E 2E 2E 22 00    Please wait...".
009E60:  0A 00 7C 01 9F 20 1E 8E 03 00 0A 00 86 01 9F 20    ..|.. ......... 
009E70:  1E 1C 02 00 07 00 90 01 01 C0 00 18 00 9A 01 01    ................
009E80:  C0 20 53 61 76 65 20 4E 65 77 20 73 74 2D 66 69    . Save New st-fi
009E90:  6C 65 00 07 00 A4 01 01 C0 00 3F 00 AE 01 BF 01    le........?.....
009EA0:  A3 20 22 4E 61 6D 65 20 6F 66 20 74 68 65 20 53    £ "Name of the S
009EB0:  6F 75 6E 64 74 72 61 6B 6B 65 72 20 66 69 6C 65    oundtrakker file
009EC0:  20 74 6F 20 73 61 76 65 20 3A 20 22 2C 03 00 00     to save : ",...
009ED0:  73 61 76 65 6E 61 6D E5 00 22 00 B8 01 A1 20 0D    savenam..".... .
009EE0:  00 00 73 74 61 72 F4 F2 0D 00 00 67 77 73 74 61    ..star.....gwsta
009EF0:  72 F4 20 EB 20 A0 20 1E EA 01 00 39 00 C2 01 BF    r. . . ....9....
009F00:  01 BF 20 22 53 61 76 65 20 61 73 20 47 68 6F 75    .. "Save as Ghou
009F10:  6C 27 73 20 77 72 69 74 65 72 20 6D 75 73 69 63    l's writer music
009F20:  20 66 69 6C 65 20 28 59 65 73 20 2F 20 4E 6F 29     file (Yes / No)
009F30:  20 3F 22 00 30 00 CC 01 03 00 00 EB EF 22 22 01     ?".0........"".
009F40:  D6 20 03 00 00 EB F2 22 59 22 20 FA 20 03 00 00    . ....."Y" . ...
009F50:  EB F2 22 4E 22 01 03 00 00 EB EF FF 1C 28 FF 43    .."N"........(.C
009F60:  29 01 D5 00 17 00 D6 01 A1 20 03 00 00 EB EF 22    )........ ....."
009F70:  4E 22 20 EB 20 A0 20 1E EA 01 00 1D 00 E0 01 9F    N" . . .........
009F80:  20 1E DE 03 01 0D 00 00 62 61 73 E5 EF 0D 00 00     .......bas.....
009F90:  67 77 73 74 61 72 F4 00 2C 00 EA 01 BF 01 BF 20    gwstar..,...... 
009FA0:  22 50 72 65 73 73 20 61 20 6B 65 79 20 74 6F 20    "Press a key to 
009FB0:  73 61 76 65 20 66 69 6C 65 2E 2E 2E 22 01 83 20    save file...".. 
009FC0:  1C 18 BB 00 34 00 F4 01 CB 20 03 00 00 73 61 76    ....4.... ...sav
009FD0:  65 6E 61 6D E5 2C 0D 00 00 E2 2C 0D 00 00 62 61    enam.,....,...ba
009FE0:  73 E5 2C 0D 00 00 6C 6F 6E E7 2C 0D 00 00 73 74    s.,...lon.,...st
009FF0:  61 72 F4 01 BF 01 98 00 07 00 FE 01 01 C0 00 17    ar..............
00A000:  6D E5 EF 03 00 00 73 61 76 65 6E 61 6D E5 F4 22    m.....savenam.."
00A010:  2E 4D 55 53 22 00 0C 00 38 04 83 20 1C 80 BE 01    .MUS"...8.. ....
00A020:  C9 00 2A 00 42 04 8C 20 32 31 2C 30 30 2C 34 30    ..*.B.. 21,00,40
00A030:  2C 31 31 2C 30 30 2C 36 30 2C 30 31 2C 30 30 2C    ,11,00,60,01,00,
00A040:  31 44 2C 45 44 2C 42 30 2C 43 39 00 07 00 4C 04    1D,ED,B0,C9...L.
00A050:  01 C0 00 23 00 56 04 01 C0 20 53 65 61 72 63 68    ...#.V... Search
00A060:  20 66 69 72 73 74 20 70 61 74 74 65 72 6E 20 61     first pattern a
00A070:  64 72 65 73 73 00 07 00 60 04 01 C0 00 1B 00 6A    dress...`......j
00A080:  04 0D 00 00 70 61 74 74 65 72 EE 20 EF 20 0D 00    ....patter. . ..
00A090:  00 64 61 74 61 64 F2 00 4F 00 74 04 0D 00 00 66    .datad..O.t....f
00A0A0:  69 6E 74 61 62 6C E5 EF 0D 00 00 62 61 73 E5 20    intabl.....bas. 
00A0B0:  F5 20 0D 00 00 6F 6C 64 73 74 61 72 F4 20 F4 20    . ...oldstar. . 
00A0C0:  FF 12 28 0D 00 00 70 61 74 74 65 72 EE 29 20 F4    ..(...patter.) .
00A0D0:  20 FF 12 28 0D 00 00 70 61 74 74 65 72 EE 20 F4     ..(...patter. .
00A0E0:  0F 29 F6 1A 00 01 00 1E 00 7E 04 0D 00 00 70 61    .).......~....pa
00A0F0:  74 74 65 72 EE EF 0D 00 00 70 61 74 74 65 72 EE    tter.....patter.
00A100:  20 F4 20 11 00 23 00 88 04 A1 20 0D 00 00 70 61     . ..#.... ...pa
00A110:  74 74 65 72 EE 20 F0 20 0D 00 00 66 69 6E 74 61    tter. . ...finta
00A120:  62 6C E5 20 EB 20 C9 00 4B 00 92 04 0D 00 00 74    bl. . ..K......t
00A130:  72 61 6E 73 69 F4 20 EF 20 0D 00 00 62 61 73 E5    ransi. . ...bas.
00A140:  F5 0D 00 00 6F 6C 64 73 74 61 72 F4 20 F4 20 FF    ....oldstar. . .
00A150:  12 28 0D 00 00 70 61 74 74 65 72 EE 29 F4 FF 12    .(...patter.)...
00A160:  28 0D 00 00 70 61 74 74 65 72 EE F4 0F 29 F6 1A    (...patter...)..
00A170:  00 01 00 54 00 9C 04 A1 20 0D 00 00 74 72 61 6E    ...T.... ...tran
00A180:  73 69 F4 20 F1 20 0D 00 00 66 69 6E 74 61 62 6C    si. . ...fintabl
00A190:  E5 20 FA 20 FF 12 28 0D 00 00 70 61 74 74 65 72    . . ..(...patter
00A1A0:  EE 20 F5 0F 29 20 F2 20 1C 80 00 20 EB 20 0D 00    . ..) . ... . ..
00A1B0:  00 66 69 6E 74 61 62 6C E5 20 EF 20 0D 00 00 74    .fintabl. . ...t
00A1C0:  72 61 6E 73 69 F4 00 0A 00 A6 04 A0 20 1E 7E 04    ransi....... .~.
00A1D0:  00 07 00 B0 04 01 C0 00 3B 00 BA 04 01 C0 20 43    ........;..... C
00A1E0:  68 61 6E 67 65 20 49 6E 74 65 72 72 75 70 74 20    hange Interrupt 
00A1F0:  6D 75 73 69 63 20 6D 6F 64 75 6C 65 20 69 6E 74    music module int
00A200:  00 08 02 01 C0 20 4D 6F 64 69 66 79 20 61 64 72    ..... Modify adr
00A210:  65 73 73 65 73 00 07 00 12 02 01 C0 00 0A 00 1C    esses...........
00A220:  02 C7 20 1E 8A 02 00 28 00 26 02 C3 20 03 00 00    .. ....(.&.. ...
00A230:  77 6F 72 EB 01 0D 00 00 77 6F 72 EB 20 EF 20 FF    wor.....wor. . .
00A240:  1D 28 22 26 22 F4 03 00 00 77 6F 72 EB 29 00 18    .("&"....wor.)..
00A250:  00 30 02 A1 20 0D 00 00 77 6F 72 EB EF 0E 20 EB    .0.. ...wor... .
00A260:  20 A0 20 1E 62 02 00 29 00 3A 02 0D 00 00 61 64     . .b..).:....ad
00A270:  B1 EF FF 12 28 0D 00 00 77 6F 72 EB 29 F4 FF 12    ....(...wor.)...
00A280:  28 0D 00 00 77 6F 72 EB F4 0F 29 F6 1A 00 01 00    (...wor...).....
00A290:  3F 00 44 02 A1 20 0D 00 00 61 64 B1 F1 0D 00 00    ?.D.. ...ad.....
00A2A0:  6F 6C 64 73 74 61 72 F4 20 FC 20 0D 00 00 61 64    oldstar. . ...ad
00A2B0:  B1 20 F0 0D 00 00 6F 6C 64 73 74 61 72 F4 F4 0D    . ....oldstar...
00A2C0:  00 00 6C 6F 6E E7 20 EB 20 A0 20 1E 58 02 00 69    ..lon. . . .X..i
00A2D0:  00 4E 02 0D 00 00 61 64 B1 EF 0D 00 00 61 64 B1    .N....ad.....ad.
00A2E0:  F4 0D 00 00 64 65 63 61 EC 01 BE 20 0D 00 00 77    ....deca... ...w
00A2F0:  6F 72 EB 2C FF 1D 28 22 26 22 F4 AC 28 FF 73 28    or.,..("&"..(.s(
00A300:  0D 00 00 61 64 B1 2C 12 29 2C 11 2C 10 29 29 01    ...ad.,.),.,.)).
00A310:  BE 20 0D 00 00 77 6F 72 EB F4 0F 2C FF 1D 28 22    . ...wor...,..("
00A320:  26 22 F4 AC 28 FF 73 28 0D 00 00 61 64 B1 2C 12    &"..(.s(...ad.,.
00A330:  29 2C 0F 2C 10 29 29 00 0A 00 58 02 A0 20 1E 26    ),.,.))...X.. .&
00A340:  02 00 06 00 62 02 C9 00 07 00 6C 02 01 C0 00 1A    ....b.....l.....
00A350:  00 76 02 01 C0 20 61 64 72 65 73 73 65 73 20 74    .v... adresses t
00A360:  6F 20 6D 6F 64 69 66 79 00 07 00 80 02 01 C0 00    o modify........
00A370:  47 00 8A 02 8C 20 34 30 30 31 2C 34 30 30 34 2C    G.... 4001,4004,
00A380:  34 30 30 37 2C 34 30 30 46 2C 34 30 31 33 2C 34    4007,400F,4013,4
00A390:  30 34 45 2C 34 30 35 32 2C 34 30 35 36 2C 34 30    04E,4052,4056,40
00A3A0:  35 42 2C 34 30 36 30 2C 34 30 36 33 2C 34 30 36    5B,4060,4063,406
00A3B0:  36 2C 34 30 36 39 00 47 00 94 02 8C 20 34 30 36    6,4069.G.... 406
00A3C0:  46 2C 34 30 37 35 2C 34 30 37 43 2C 34 30 38 33    F,4075,407C,4083
00A3D0:  2C 34 30 38 41 2C 34 30 39 31 2C 34 30 39 34 2C    ,408A,4091,4094,
00A3E0:  34 30 39 39 2C 34 30 39 43 2C 34 30 39 46 2C 34    4099,409C,409F,4
00A3F0:  30 41 33 2C 34 30 41 36 2C 34 30 41 39 00 42 00    0A3,40A6,40A9.B.
00A400:  6F 20 72 61 77 20 6D 75 73 69 63 20 6D 6F 64 75    o raw music modu
00A410:  6C 65 00 07 00 C4 04 01 C0 00 38 00 CE 04 C7 20    le........8.... 
00A420:  1E EC 04 01 9E 20 0D 00 00 E9 EF 1C 80 BE 20 EC    ..... ........ .
00A430:  20 1C 8B BE 01 C3 20 03 00 00 E1 01 BE 20 0D 00     ..... ...... ..
00A440:  00 E9 2C FF 1D 28 22 26 22 F4 03 00 00 E1 29 01    ..,..("&".....).
00A450:  B0 00 1C 00 D8 04 0D 00 00 6C 6F 6E E7 20 EF 20    .........lon. . 
00A460:  0D 00 00 6C 6F 6E E7 20 F5 20 1C 24 00 00 52 00    ...lon. . .$..R.
00A470:  E2 04 BE 20 1C 87 BE 2C FF 1D 28 22 26 22 F4 AC    ... ...,..("&"..
00A480:  28 FF 73 28 0D 00 00 6C 6F 6E E7 2C 12 29 2C 11    (.s(...lon.,.),.
00A490:  2C 10 29 29 01 BE 20 1C 88 BE 2C FF 1D 28 22 26    ,.)).. ...,..("&
00A4A0:  22 F4 AC 28 FF 73 28 0D 00 00 6C 6F 6E E7 2C 12    "..(.s(...lon.,.
00A4B0:  29 2C 0F 2C 10 29 29 01 83 20 1C 80 BE 01 C9 00    ),.,.)).. ......
00A4C0:  2A 00 EC 04 8C 20 32 31 2C 32 34 2C 34 30 2C 31    *.... 21,24,40,1
00A4D0:  31 2C 30 30 2C 34 30 2C 30 31 2C 30 30 2C 30 30    1,00,40,01,00,00
00A4E0:  2C 45 44 2C 42 30 2C 43 39 00 00 00 1A CB B7 03    ,ED,B0,C9.......
00A4F0:  C6 B7 00 C9 B7 03 FF 55 10 F5 04 54 08 F5 05 50    .......U...T...P
00A500:  20 F4 20 11 00 23 00 88 04 A1 20 0D 00 00 70 61     . ..#.... ...pa
00A510:  74 74 65 72 EE 20 F0 20 0D 00 00 66 69 6E 74 61    tter. . ...finta
00A520:  62 6C E5 20 EB 20 C9 00 4B 00 92 04 0D 00 00 74    bl. . ..K......t
00A530:  72 61 6E 73 69 F4 20 EF 20 0D 00 00 62 61 73 E5    ransi. . ...bas.
00A540:  F5 0D 00 00 6F 6C 64 73 74 61 72 F4 20 F4 20 FF    ....oldstar. . .
00A550:  12 28 0D 00 00 70 61 74 74 65 72 EE 29 F4 FF 12    .(...patter.)...
00A560:  28 0D 00 00 70 61 74 74 65 72 EE F4 0F 29 F6 1A    (...patter...)..
00A570:  00 01 00 54 00 9C 04 A1 20 0D 00 00 74 72 61 6E    ...T.... ...tran
00A580:  73 69 F4 20 F1 20 0D 00 00 66 69 6E 74 61 62 6C    si. . ...fintabl
00A590:  E5 20 FA 20 FF 12 28 0D 00 00 70 61 74 74 65 72    . . ..(...patter
00A5A0:  EE 20 F5 0F 29 20 F2 20 1C 80 00 20 EB 20 0D 00    . ..) . ... . ..
00A5B0:  00 66 69 6E 74 61 62 6C E5 20 EF 20 0D 00 00 74    .fintabl. . ...t
00A5C0:  72 61 6E 73 69 F4 00 0A 00 A6 04 A0 20 1E 7E 04    ransi....... .~.
00A5D0:  00 07 00 B0 04 01 C0 00 3B 00 BA 04 01 C0 20 43    ........;..... C
00A5E0:  68 61 6E 67 65 20 49 6E 74 65 72 72 75 70 74 20    hange Interrupt 
00A5F0:  6D 75 73 69 63 20 6D 6F 64 75 6C 65 20 69 6E 74    music module int
00A600:  9E 02 8C 20 34 30 41 44 2C 34 30 42 30 2C 34 30    ... 40AD,40B0,40
00A610:  42 33 2C 34 30 42 44 2C 34 30 43 32 2C 34 30 43    B3,40BD,40C2,40C
00A620:  43 2C 34 30 44 31 2C 34 30 44 42 2C 34 30 45 30    C,40D1,40DB,40E0
00A630:  2C 34 30 45 41 2C 34 30 45 46 2C 34 30 46 38 00    ,40EA,40EF,40F8.
00A640:  3D 00 A8 02 8C 20 34 31 30 37 2C 34 31 32 31 2C    =.... 4107,4121,
00A650:  34 31 34 41 2C 34 31 34 45 2C 34 31 35 34 2C 34    414A,414E,4154,4
00A660:  31 37 38 2C 34 31 42 31 2C 34 31 43 46 2C 34 31    178,41B1,41CF,41
00A670:  44 34 2C 34 31 44 39 2C 34 31 44 45 00 47 00 B2    D4,41D9,41DE.G..
00A680:  02 8C 20 34 32 32 44 2C 34 32 35 30 2C 34 32 35    .. 422D,4250,425
00A690:  37 2C 34 32 37 35 2C 34 32 38 46 2C 34 32 39 35    7,4275,428F,4295
00A6A0:  2C 34 32 39 38 2C 34 32 39 44 2C 34 32 41 38 2C    ,4298,429D,42A8,
00A6B0:  34 32 42 41 2C 34 32 42 46 2C 34 32 43 32 2C 34    42BA,42BF,42C2,4
00A6C0:  32 43 41 00 15 00 BC 02 8C 20 34 32 44 41 2C 34    2CA...... 42DA,4
00A6D0:  32 44 46 2C 34 32 45 32 00 15 00 C6 02 8C 20 34    2DF,42E2...... 4
00A6E0:  33 30 36 2C 34 33 30 38 2C 34 33 30 41 00 24 00    306,4308,430A.$.
00A6F0:  D0 02 8C 20 34 34 34 32 2C 34 34 34 34 2C 34 34    ... 4442,4444,44
00A700:  34 36 2C 34 34 34 41 2C 34 34 34 43 2C 34 34 34    46,444A,444C,444
00A710:  45 00 24 00 DA 02 8C 20 34 34 35 32 2C 34 34 35    E.$.... 4452,445
00A720:  34 2C 34 34 35 36 2C 34 34 35 41 2C 34 34 35 43    4,4456,445A,445C
00A730:  2C 34 34 35 45 00 24 00 E4 02 8C 20 34 34 36 32    ,445E.$.... 4462
00A740:  2C 34 34 36 34 2C 34 34 36 36 2C 34 34 36 41 2C    ,4464,4466,446A,
00A750:  34 34 36 43 2C 34 34 36 45 00 24 00 EE 02 8C 20    446C,446E.$.... 
00A760:  34 34 37 32 2C 34 34 37 34 2C 34 34 37 36 2C 34    4472,4474,4476,4
00A770:  34 37 41 2C 34 34 37 43 2C 34 34 37 45 00 24 00    47A,447C,447E.$.
00A780:  F8 02 8C 20 34 34 38 32 2C 34 34 38 34 2C 34 34    ... 4482,4484,44
00A790:  38 36 2C 34 34 38 41 2C 34 34 38 43 2C 34 34 38    86,448A,448C,448
00A7A0:  45 00 24 00 02 03 8C 20 34 34 39 32 2C 34 34 39    E.$.... 4492,449
00A7B0:  34 2C 34 34 39 36 2C 34 34 39 41 2C 34 34 39 43    4,4496,449A,449C
00A7C0:  2C 34 34 39 45 00 24 00 0C 03 8C 20 34 34 41 32    ,449E.$.... 44A2
00A7D0:  2C 34 34 41 34 2C 34 34 41 36 2C 34 34 41 41 2C    ,44A4,44A6,44AA,
00A7E0:  34 34 41 43 2C 34 34 41 45 00 24 00 16 03 8C 20    44AC,44AE.$.... 
00A7F0:  34 34 42 32 2C 34 34 42 34 2C 34 34 42 36 2C 34    44B2,44B4,44B6,4
00A800:  00 2D 47 57 46 4F 4E 54 20 42 41 53 00 00 00 00    .-GWFONT BAS....
00A810:  00 00 00 00 00 70 01 00 B8 03 00 00 00 00 00 00    .....p..........
00A820:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00A830:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00A840:  B8 03 00 DF 04 2E 2E 20 22 01 83 20 1C 18 BB 00    ....... ".. ....
00A850:  2B 00 90 01 CB 20 03 00 00 73 61 76 65 66 69 6C    +.... ...savefil
00A860:  E5 2C 0D 00 00 E2 2C 0D 00 00 66 6F 6E 74 E5 2C    .,....,...font.,
00A870:  0D 00 00 61 64 F2 F5 1C 00 90 00 00 00 1A E5 2C    ...ad..........,
00A880:  26 00 01 00 01 C0 20 47 68 6F 75 6C 27 73 20 77    &..... Ghoul's w
00A890:  72 69 74 65 72 20 2E 66 6E 74 20 66 69 6C 65 20    riter .fnt file 
00A8A0:  6D 61 6B 65 72 00 07 00 02 00 01 C0 00 24 00 03    maker........$..
00A8B0:  00 01 C0 20 54 6F 6D 20 65 74 20 4A 65 72 72 79    ... Tom et Jerry
00A8C0:  20 6F 66 20 47 50 41 20 28 63 29 20 31 39 39 34     of GPA (c) 1994
00A8D0:  00 07 00 04 00 01 C0 00 4B 00 05 00 01 C0 20 52    ........K..... R
00A8E0:  65 6D 65 6D 62 65 72 2C 20 6F 6E 6C 79 20 77 6F    emember, only wo
00A8F0:  72 6B 73 20 77 69 74 68 20 66 6F 6E 74 20 6C 6F    rks with font lo
00A900:  61 64 65 64 20 69 6E 20 52 41 4D 20 77 69 74 68    aded in RAM with
00A910:  20 53 79 6D 62 6F 6C 20 63 6F 6D 6D 61 6E 64 73     Symbol commands
00A920:  20 21 00 07 00 06 00 01 C0 00 19 00 0A 00 82 20     !............. 
00A930:  0E 01 A2 20 0E 2C 0E 01 A2 20 0F 2C 19 1A 01 AD    ... .,... .,....
00A940:  20 10 00 45 00 14 00 BF 20 22 47 68 6F 75 6C 27     ..E.... "Ghoul'
00A950:  73 20 77 72 69 74 65 72 20 2E 66 6E 74 20 66 69    s writer .fnt fi
00A960:  6C 65 20 6D 61 6B 65 72 20 20 54 6F 6D 20 65 74    le maker  Tom et
00A970:  20 4A 65 72 72 79 20 6F 66 20 47 50 41 20 28 63     Jerry of GPA (c
00A980:  29 20 31 39 39 34 22 00 1D 00 1E 00 BF 20 FF 7B    ) 1994"...... .{
00A990:  28 19 50 2C 22 5F 22 29 01 D8 20 0F 2C 19 50 2C    (.P,"_").. .,.P,
00A9A0:  12 2C 19 19 00 07 00 28 00 01 C0 00 19 00 32 00    .,.....(......2.
00A9B0:  01 C0 20 56 61 72 69 61 62 6C 65 73 20 64 65 20    .. Variables de 
00A9C0:  62 61 73 65 00 07 00 3C 00 01 C0 00 4A 00 46 00    base...<....J.F.
00A9D0:  0D 00 00 6E 62 63 68 61 72 F3 EF 19 60 01 0D 00    ...nbchar...`...
00A9E0:  00 6E 62 6C 69 6E 65 F3 EF 16 01 0D 00 00 73 63    .nbline.......sc
00A9F0:  72 65 65 EE EF 1C 00 C0 01 0D 00 00 66 6F 6E 74    ree.........font
00AA00:  34 42 41 2C 34 34 42 43 2C 34 34 42 45 00 29 00    4BA,44BC,44BE.).
00AA10:  20 03 8C 20 34 34 43 32 2C 34 34 43 34 2C 34 34     .. 44C2,44C4,44
00AA20:  43 36 2C 34 34 43 38 2C 34 34 43 41 2C 34 34 43    C6,44C8,44CA,44C
00AA30:  43 2C 34 34 43 45 00 33 00 2A 03 8C 20 34 34 44    C,44CE.3.*.. 44D
00AA40:  30 2C 34 34 44 32 2C 34 34 44 34 2C 34 34 44 36    0,44D2,44D4,44D6
00AA50:  2C 34 34 44 38 2C 34 34 44 41 2C 34 34 44 43 2C    ,44D8,44DA,44DC,
00AA60:  34 34 44 45 2C 34 34 45 30 00 08 00 34 03 8C 20    44DE,44E0...4.. 
00AA70:  30 00 07 00 3E 03 01 C0 00 0E 00 48 03 01 C0 20    0...>......H... 
00AA80:  48 65 61 64 65 72 00 07 00 52 03 01 C0 00 38 00    Header...R....8.
00AA90:  5C 03 C7 20 1E 66 03 01 9E 20 0D 00 00 E9 EF 1C    \.. .f... ......
00AAA0:  80 BE 20 EC 20 1C 96 BE 01 C3 20 03 00 00 E1 01    .. . ..... .....
00AAB0:  BE 20 0D 00 00 E9 2C FF 1D 28 22 26 22 F4 03 00    . ....,..("&"...
00AAC0:  00 E1 29 01 B0 00 39 00 66 03 8C 20 32 31 2C 41    ..)...9.f.. 21,A
00AAD0:  30 2C 42 45 2C 31 31 2C 30 30 2C 43 30 2C 30 36    0,BE,11,00,C0,06
00AAE0:  2C 30 38 2C 43 44 2C 37 37 2C 42 43 2C 37 39 2C    ,08,CD,77,BC,79,
00AAF0:  33 32 2C 42 30 2C 42 45 2C 37 38 2C 33 32 00 18    32,B0,BE,78,32..
00AB00:  00 70 03 8C 20 42 31 2C 42 45 2C 43 44 2C 39 32    .p.. B1,BE,CD,92
00AB10:  2C 42 43 2C 43 39 00 5E 00 7A 03 9E 20 0D 00 00    ,BC,C9.^.z.. ...
00AB20:  C9 EF 0F 20 EC 20 FF 0E 28 03 00 00 6C 6F 61 64    ... . ..(...load
00AB30:  6E 61 6D E5 29 01 BE 20 1C 9F BE 20 F4 20 0D 00    nam.).. ... . ..
00AB40:  00 E9 2C FF 01 28 AC 28 03 00 00 6C 6F 61 64 6E    ..,..(.(...loadn
00AB50:  61 6D E5 2C 0D 00 00 E9 2C 0F 29 29 01 B0 01 BE    am.,....,.))....
00AB60:  20 1C 87 BE 2C FF 0E 28 03 00 00 6C 6F 61 64 6E     ...,..(...loadn
00AB70:  61 6D E5 29 00 28 00 84 03 83 20 1C 80 BE 01 0D    am.).(.... .....
00AB80:  00 00 6C 6F 6E E7 EF FF 12 28 1C B0 BE 29 F4 FF    ..lon....(...)..
00AB90:  12 28 1C B1 BE 29 F6 1A 00 01 01 C9 00 07 00 8E    .(...)..........
00ABA0:  03 01 C0 00 15 00 98 03 01 C0 20 4D 6F 64 69 66    .......... Modif
00ABB0:  79 20 74 61 62 6C 65 73 00 07 00 A2 03 01 C0 00    y tables........
00ABC0:  40 00 AC 03 0D 00 00 64 61 74 61 64 F2 20 EF 20    @......datad. . 
00ABD0:  0D 00 00 62 61 73 E5 20 F5 20 0D 00 00 6F 6C 64    ...bas. . ...old
00ABE0:  73 74 61 72 F4 20 F4 20 FF 12 28 1C 06 43 29 F4    star. . ..(..C).
00ABF0:  FF 12 28 1C 07 43 29 F6 1A 00 01 20 F4 0F 20 00    ..(..C).... .. .
00AC00:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
00AC10:  09 00 01 00 02 09 4E E5 09 00 C1 02 00 00 00 02    ......N.........
00AC20:  09 00 C6 02 00 00 00 02 09 00 C2 02 00 00 00 02    ................
00AC30:  09 00 C7 02 00 00 00 02 09 00 C3 02 00 00 00 02    ................
00AC40:  09 00 C8 02 00 00 00 02 09 00 C4 02 00 00 00 02    ................
00AC50:  09 00 C9 02 00 00 00 02 09 00 C5 02 00 00 00 02    ................
00AC60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00AC70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00AC80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00AC90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00ACA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00ACB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00ACC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00ACD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00ACE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00ACF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00AD00:  E5 EF 1C 00 90 01 0D 00 00 61 64 F2 EF 0D 00 00    .........ad.....
00AD10:  66 6F 6E 74 E5 00 07 00 D2 00 01 C0 00 1C 00 DC    font............
00AD20:  00 01 C0 20 50 72 69 6E 74 20 66 6F 6E 74 20 69    ... Print font i
00AD30:  6E 20 6D 65 6D 6F 72 79 00 07 00 E6 00 01 C0 00    n memory........
00AD40:  23 00 F0 00 8A 01 9E 20 0D 00 00 E9 EF 19 20 20    #...... ......  
00AD50:  EC 20 19 80 01 BF 20 FF 03 28 0D 00 00 E9 29 3B    . .... ..(....);
00AD60:  01 B0 00 12 00 FA 00 0D 00 00 73 63 72 65 65 EE    ..........scree.
00AD70:  EF 1C F0 C0 00 08 00 04 01 01 C0 20 00 14 00 0E    ........... ....
00AD80:  01 01 C0 20 6D 61 69 6E 20 77 6F 72 6B 2E 2E 2E    ... main work...
00AD90:  00 07 00 18 01 01 C0 00 20 00 22 01 9E 20 0D 00    ........ .".. ..
00ADA0:  00 EA EF 0E 20 EC 20 28 0D 00 00 6E 62 63 68 61    .... . (...nbcha
00ADB0:  72 F3 20 F5 20 0F 29 00 1C 00 2C 01 9E 20 0D 00    r. . .)...,.. ..
00ADC0:  00 E9 EF 0E 20 EC 20 0D 00 00 6E 62 6C 69 6E 65    .... . ...nbline
00ADD0:  F3 F5 0F 00 22 00 36 01 0D 00 00 74 72 61 73 E8    ....".6....tras.
00ADE0:  EF 0D 00 00 73 63 72 65 65 EE F4 28 0D 00 00 E9    ....scree..(....
00ADF0:  F6 1C 00 08 29 00 43 00 40 01 BE 20 0D 00 00 61    ....).C.@.. ...a
00AE00:  64 F2 2C FF 12 28 0D 00 00 74 72 61 73 E8 F4 0D    d.,..(...tras...
00AE10:  00 00 EA 29 01 BE 20 0D 00 00 74 72 61 73 E8 F4    ...).. ...tras..
00AE20:  0D 00 00 EA 2C 1C FF 00 01 0D 00 00 61 64 F2 EF    ....,.......ad..
00AE30:  0D 00 00 61 64 F2 F4 0F 00 08 00 4A 01 B0 01 B0    ...ad......J....
00AE40:  00 07 00 54 01 01 C0 00 18 00 5E 01 01 C0 20 53    ...T......^... S
00AE50:  61 76 65 20 66 6F 6E 74 20 66 69 6C 65 20 21 00    ave font file !.
00AE60:  07 00 68 01 01 C0 00 4D 00 72 01 8A 01 A3 20 22    ..h....M.r...£ "
00AE70:  4E 61 6D 65 20 6F 66 20 74 68 65 20 66 6F 6E 74    Name of the font
00AE80:  20 66 69 6C 65 20 74 6F 20 73 61 76 65 20 28 6E     file to save (n
00AE90:  6F 20 65 78 74 65 6E 73 69 6F 6E 20 70 6C 65 61    o extension plea
00AEA0:  73 65 29 20 3A 20 22 2C 03 00 00 73 61 76 65 66    se) : ",...savef
00AEB0:  69 6C E5 00 2A 00 7C 01 03 00 00 73 61 76 65 66    il..*.|....savef
00AEC0:  69 6C E5 EF AC 28 03 00 00 73 61 76 65 66 69 6C    il...(...savefil
00AED0:  E5 2C 0F 2C 16 29 F4 22 2E 46 4E 54 22 00 2D 00    .,.,.).".FNT".-.
00AEE0:  86 01 BF 01 BF 20 22 50 72 65 73 73 20 61 20 6B    ..... "Press a k
00AEF0:  65 79 20 74 6F 20 73 61 76 65 20 66 69 6C 65 2E    ey to save file.
00AF00:  00 43 48 41 4D 50 41 47 32 47 57 58 00 00 00 00    .CHAMPAG2GWX....
00AF10:  00 00 02 00 00 00 96 00 40 01 00 96 00 00 00 00    ........@.......
00AF20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00AF30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00AF40:  40 01 00 C9 04 42 2F 0B 06 24 0C 5E 3A 04 28 16    @....B/..$.^:.(.
00AF50:  01 36 46 09 64 01 00 7A 08 04 2C 13 03 4E 17 09    .6F.d..z..,..N..
00AF60:  02 45 0C 26 35 07 5E 3F 02 88 26 06 34 49 0A 68    .E.&5.^?..&.4I.h
00AF70:  31 02 08 08 04 04 02 02 01 01 02 02 04 04 08 08    1...............
00AF80:  C3 07 96 C3 23 96 C9 21 00 98 11 06 C2 3E 90 73    ....#..!.....>.s
00AF90:  23 72 23 EB 01 00 08 09 30 04 01 4A C0 09 EB 3D    #r#.....0..J...=
00AFA0:  20 ED C9 3E 10 DD 21 DF 96 16 00 08 01 00 98 DD     ..>..!.........
00AFB0:  6E 00 5D 62 29 09 4E 23 46 DD 6E 01 62 09 7E E6    n.]b).N#F.n.b.~.
00AFC0:  F0 77 7B A7 20 07 3E 8E DD 77 00 18 29 3D DD 77    .w{. .>..w..)=.w
00AFD0:  00 01 00 F8 09 7C D6 C0 30 04 01 B6 3F 09 5D 54    .....|..0...?.]T
00AFE0:  21 2D 97 06 00 DD 4E 02 79 FE 0E 20 01 48 09 0C    !-....N.y.. .H..
00AFF0:  DD 71 02 1A 86 12 DD 23 DD 23 DD 23 08 3D 20 A9    .q.....#.#.#.= .
00B000:  3E 0A DD 21 0F 97 16 00 08 01 00 98 DD 6E 00 62    >..!.........n.b
00B010:  5D 29 09 4E 23 46 DD 6E 01 62 09 7E E6 F0 77 7B    ]).N#F.n.b.~..w{
00B020:  A7 20 07 3E 8E DD 77 00 18 2A 3D 3D DD 77 00 01    . .>..w..*==.w..
00B030:  00 F0 09 7C D6 C0 30 04 01 B6 3F 09 5D 54 21 2D    ...|..0...?.]T!-
00B040:  97 06 00 DD 4E 02 79 FE 0E 20 01 48 09 0C DD 71    ....N.y.. .H...q
00B050:  02 1A 86 12 DD 23 DD 23 DD 23 08 3D 20 A8 C9 0C    .....#.#.#.= ...
00B060:  06 00 78 2D 01 2C 20 02 56 43 03 1E 38 04 8C 1C    ..x-., .VC..8...
00B070:  05 18 33 06 48 03 07 32 10 08 64 1A 09 84 0B 0A    ..3.H..2..d.....
00B080:  42 2F 0B 06 24 0C 5E 3A 04 28 16 01 36 46 09 64    B/..$.^:.(..6F.d
00B090:  01 00 7A 08 04 2C 13 03 4E 17 09 02 45 0C 26 35    ..z..,..N...E.&5
00B0A0:  07 5E 3F 02 88 26 06 34 49 0A 68 31 02 08 08 04    .^?..&.4I.h1....
00B0B0:  04 02 02 01 01 02 02 04 04 08 08 00 00 00 00 00    ................
00B0C0:  1A 20 31 30 34 2C 34 39 2C 32 0D 0A 0D 0A 74 61    . 104,49,2....ta
00B0D0:  62 5F 70 6F 69 6E 74 20 64 62 20 38 2C 38 2C 34    b_point db 8,8,4
00B0E0:  2C 34 2C 32 2C 32 2C 31 2C 31 2C 32 2C 32 2C 34    ,4,2,2,1,1,2,2,4
00B0F0:  2C 34 2C 38 2C 38 0D 0A 1A 20 26 39 36 30 30 0D    ,4,8,8... &9600.
00B100:  2E 2E 20 22 01 83 20 1C 18 BB 00 2B 00 90 01 CB    .. ".. ....+....
00B110:  20 03 00 00 73 61 76 65 66 69 6C E5 2C 0D 00 00     ...savefil.,...
00B120:  E2 2C 0D 00 00 66 6F 6E 74 E5 2C 0D 00 00 61 64    .,...font.,...ad
00B130:  F2 F5 1C 00 90 00 00 00 1A E5 2C 0D 00 00 E2 2C    ..........,....,
00B140:  0D 00 00 66 6F 6E 74 E5 2C 0D 00 00 61 64 F2 F5    ...font.,...ad..
00B150:  1C 00 90 00 00 00 1A 00 8A 01 BF 20 FF 73 28 0D    ........... .s(.
00B160:  00 00 61 64 F2 F5 1C 00 90 29 00 00 00 1A 90 29    ..ad.....).....)
00B170:  00 00 00 1A 29 00 00 00 1A 00 00 00 00 00 00 00    ....)...........
00B180:  01 01 C0 20 6D 61 69 6E 20 77 6F 72 6B 2E 2E 2E    ... main work...
00B190:  00 07 00 18 01 01 C0 00 20 00 22 01 9E 20 0D 00    ........ .".. ..
00B1A0:  00 EA EF 0E 20 EC 20 28 0D 00 00 6E 62 63 68 61    .... . (...nbcha
00B1B0:  72 F3 20 F5 20 0F 29 00 1C 00 2C 01 9E 20 0D 00    r. . .)...,.. ..
00B1C0:  00 E9 EF 0E 20 EC 20 0D 00 00 6E 62 6C 69 6E 65    .... . ...nbline
00B1D0:  F3 F5 0F 00 22 00 36 01 0D 00 00 74 72 61 73 E8    ....".6....tras.
00B1E0:  EF 0D 00 00 73 63 72 65 65 EE F4 28 0D 00 00 E9    ....scree..(....
00B1F0:  F6 1C 00 08 29 00 43 00 40 01 BE 20 0D 00 00 61    ....).C.@.. ...a
00B200:  64 F2 2C FF 12 28 0D 00 00 74 72 61 73 E8 F4 0D    d.,..(...tras...
00B210:  00 00 EA 29 01 BE 20 0D 00 00 74 72 61 73 E8 F4    ...).. ...tras..
00B220:  0D 00 00 EA 2C 1C FF 00 01 0D 00 00 61 64 F2 EF    ....,.......ad..
00B230:  0D 00 00 61 64 F2 F4 0F 00 08 00 4A 01 B0 01 B0    ...ad......J....
00B240:  00 07 00 54 01 01 C0 00 18 00 5E 01 01 C0 20 53    ...T......^... S
00B250:  61 76 65 20 66 6F 6E 74 20 66 69 6C 65 20 21 00    ave font file !.
00B260:  07 00 68 01 01 C0 00 4D 00 72 01 8A 01 A3 20 22    ..h....M.r...£ "
00B270:  4E 61 6D 65 20 6F 66 20 74 68 65 20 66 6F 6E 74    Name of the font
00B280:  20 66 69 6C 65 20 74 6F 20 73 61 76 65 20 28 6E     file to save (n
00B290:  6F 20 65 78 74 65 6E 73 69 6F 6E 20 70 6C 65 61    o extension plea
00B2A0:  73 65 29 20 3A 20 22 2C 03 00 00 73 61 76 65 66    se) : ",...savef
00B2B0:  69 6C E5 00 2A 00 7C 01 03 00 00 73 61 76 65 66    il..*.|....savef
00B2C0:  69 6C E5 EF AC 28 03 00 00 73 61 76 65 66 69 6C    il...(...savefil
00B2D0:  E5 2C 0F 2C 16 29 F4 22 2E 46 4E 54 22 00 2D 00    .,.,.).".FNT".-.
00B2E0:  86 01 BF 01 BF 20 22 50 72 65 73 73 20 61 20 6B    ..... "Press a k
00B2F0:  65 79 20 74 6F 20 73 61 76 65 20 66 69 6C 65 2E    ey to save file.
00B300:  78 74 20 20 5B 46 5D 6F 6E 74 20 20 5B 4C 5D 6F    xt  [F]ont  [L]o
00B310:  67 6F 20 20 5B 4D 5D 75 73 69 63 20 20 5B 31 5D    go  [M]usic  [1]
00B320:  73 74 20 73 66 78 20 20 20 5B 32 5D 6E 64 20 73    st sfx   [2]nd s
00B330:  66 78 00 04 01 43 6F 6D 6D 61 6E 64 20 20 20 3A    fx...Command   :
00B340:  20 28 44 29 69 72 20 20 20 28 41 29 3A 20 20 20     (D)ir   (A):   
00B350:  20 28 42 29 3A 20 20 20 20 28 4F 29 70 65 6E 20     (B):    (O)pen 
00B360:  20 20 28 53 29 61 76 65 20 61 6C 6C 20 20 28 43      (S)ave all  (C
00B370:  29 6F 6E 66 69 67 20 20 28 56 29 69 65 77 00 05    )onfig  (V)iew..
00B380:  01 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A    ................
00B390:  9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A    ................
00B3A0:  9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A    ................
00B3B0:  9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A    ................
00B3C0:  9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A    ................
00B3D0:  9A 00 01 3A 46 69 6C 65 20 20 20 3A 20 20 3A 20    ...:File   :  : 
00B3E0:  20 20 20 20 20 20 20 2E 20 20 20 00 CD 18 BB FE           .   .....
00B3F0:  31 CA 17 0F FE 32 CA 1E 0F E6 DF FE 49 CA 03 0B    1....2......I...
00B400:  FE 44 CA 52 09 FE 4F CA 88 0B FE 53 CA 38 0D FE    .D.R..O....S.8..
00B410:  41 CA 9E 0E FE 42 CA AB 0E FE 54 CA D2 0E FE 4C    A....B....T....L
00B420:  CA 09 0F FE 46 CA 10 0F FE 4D CA 02 0F FE 43 C2    ....F....M....C.
00B430:  F8 0A CD 40 00 C3 AC 0A FE 56 C2 AC 0A CD 43 00    ...@.....V....C.
00B440:  C3 A5 08 CD F7 08 21 1B 0B CD E5 08 21 39 0B CD    ......!.....!9..
00B450:  E5 08 21 58 0B CD E5 08 C3 AC 0A 0B 1B 47 68 6F    ..!X.........Gho
00B460:  75 6C 27 73 20 57 72 69 74 65 72 20 4C 69 6E 6B    ul's Writer Link
00B470:  65 72 20 20 76 31 2E 30 00 0D 1A 43 6F 64 65 64    er  v1.0...Coded
00B480:  20 62 79 20 54 6F 6D 20 65 74 20 4A 65 72 72 79     by Tom et Jerry
00B490:  20 6F 66 20 47 50 41 00 0F 1A 54 68 69 73 20 70     of GPA...This p
00B4A0:  72 6F 67 72 61 6D 20 69 73 20 73 68 61 72 65 77    rogram is sharew
00B4B0:  61 72 65 20 21 21 00 0E FF 0C D6 0A 30 FB C6 3A    are !!......0..:
00B4C0:  23 77 2B 79 C6 30 77 C9 CD F7 08 CD 1A 09 21 2B    #w+y.0w.......!+
00B4D0:  0C CD E5 08 21 0B 08 11 1A 08 01 0C 00 ED B0 21    ....!..........!
00B4E0:  18 08 CD 9B 0C FE FC 20 06 CD F7 08 C3 AC 0A CD    ....... ........
00B4F0:  F7 08 3A 5A BB 32 27 08 3E C9 32 5A BB 21 1A 08    ..:Z.2'.>.2Z.!..
00B500:  00 12 00 FA 00 0D 00 00 73 63 72 65 65 EE EF 1C    ........scree...
00B510:  F0 C0 00 08 00 04 01 01 C0 20 00 14 00 0E 01 01    ......... ......
00B520:  C0 20 6D 61 69 6E 20 77 6F 72 6B 2E 2E 2E 00 07    . main work.....
00B530:  00 18 01 01 C0 00 20 00 22 01 9E 20 0D 00 00 EA    ...... .".. ....
00B540:  EF 0E 20 EC 20 28 0D 00 00 6E 62 63 68 61 72 F3    .. . (...nbchar.
00B550:  20 F5 20 0F 29 00 1C 00 2C 01 9E 20 0D 00 00 E9     . .)...,.. ....
00B560:  EF 0E 20 EC 20 0D 00 00 6E 62 6C 69 6E 65 F3 F5    .. . ...nbline..
00B570:  0F 00 22 00 36 01 0D 00 00 74 72 61 73 E8 EF 0D    ..".6....tras...
00B580:  00 00 73 63 72 65 65 EE F4 28 0D 00 00 E9 F6 1C    ..scree..(......
00B590:  00 08 29 00 43 00 40 01 BE 20 0D 00 00 61 64 F2    ..).C.@.. ...ad.
00B5A0:  2C FF 12 28 0D 00 00 74 72 61 73 E8 F4 0D 00 00    ,..(...tras.....
00B5B0:  EA 29 01 BE 20 0D 00 00 74 72 61 73 E8 F4 0D 00    .).. ...tras....
00B5C0:  00 EA 2C 1C FF 00 01 0D 00 00 61 64 F2 EF 0D 00    ..,.......ad....
00B5D0:  00 61 64 F2 F4 0F 00 08 00 4A 01 B0 01 B0 00 07    .ad......J......
00B5E0:  00 54 01 01 C0 00 18 00 5E 01 01 C0 20 53 61 76    .T......^... Sav
00B5F0:  65 20 66 6F 6E 74 20 66 69 6C 65 20 21 00 07 00    e font file !...
00B600:  68 01 01 C0 00 4D 00 72 01 8A 01 A3 20 22 4E 61    h....M.r...£ "Na
00B610:  6D 65 20 6F 66 20 74 68 65 20 66 6F 6E 74 20 66    me of the font f
00B620:  69 6C 65 20 74 6F 20 73 61 76 65 20 28 6E 6F 20    ile to save (no 
00B630:  65 78 74 65 6E 73 69 6F 6E 20 70 6C 65 61 73 65    extension please
00B640:  29 20 3A 20 22 2C 03 00 00 73 61 76 65 66 69 6C    ) : ",...savefil
00B650:  E5 00 2A 00 7C 01 03 00 00 73 61 76 65 66 69 6C    ..*.|....savefil
00B660:  E5 EF AC 28 03 00 00 73 61 76 65 66 69 6C E5 2C    ...(...savefil.,
00B670:  0F 2C 16 29 F4 22 2E 46 4E 54 22 00 2D 00 86 01    .,.).".FNT".-...
00B680:  BF 01 BF 20 22 50 72 65 73 73 20 61 20 6B 65 79    ... "Press a key
00B690:  20 74 6F 20 73 61 76 65 20 66 69 6C 65 2E 2E 2E     to save file...
00B6A0:  20 22 01 83 20 1C 18 BB 00 2B 00 90 01 CB 20 03     ".. ....+.... .
00B6B0:  00 00 73 61 76 65 66 69 6C E5 2C 0D 00 00 E2 2C    ..savefil.,....,
00B6C0:  0D 00 00 66 6F 6E 74 E5 2C 0D 00 00 61 64 F2 F5    ...font.,...ad..
00B6D0:  1C 00 90 00 00 00 1A 00 8A 01 BF 20 FF 73 28 0D    ........... .s(.
00B6E0:  00 00 61 64 F2 F5 1C 00 90 29 00 00 00 1A 90 29    ..ad.....).....)
00B6F0:  00 00 00 1A 29 00 00 00 1A 00 00 00 00 00 00 00    ....)...........
00B700:  00 43 55 52 54 41 49 4E 20 47 57 45 00 00 00 00    .CURTAIN GWE....
00B710:  00 00 02 00 00 00 90 00 91 00 00 00 00 00 00 00    ................
00B720:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00B730:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00B740:  91 00 00 CD 04 0F 0E 0D 0C 0B 0A 09 08 07 06 05    ................
00B750:  04 03 02 01 00 FF 1A 00 00 61 64 F2 2C 1C FF 00    .........ad.,...
00B760:  00 20 00 3C 00 CB 20 22 70 63 2D 63 67 61 2E 67    . .<.. "pc-cga.g
00B770:  77 65 22 2C 0D 00 00 E2 2C 1C 00 90 2C 1C 91 00    we",....,...,...
00B780:  8F 8E 8D 8C 8B 8A 89 88 87 86 85 84 83 82 81 80    ................
00B790:  7F 7E 7D 7C 7B 7A 79 78 77 76 75 74 73 72 71 70    .~}|{zyxwvutsrqp
00B7A0:  6F 6E 6D 6C 6B 6A 69 68 67 66 65 64 63 62 61 60    onmlkjihgfedcba`
00B7B0:  5F 5E 5D 5C 5B 5A 59 58 57 56 55 54 53 52 51 50    _^]\[ZYXWVUTSRQP
00B7C0:  4F 4E 4D 4C 4B 4A 49 48 47 46 45 44 43 42 41 40    ONMLKJIHGFEDCBA@
00B7D0:  3F 3E 3D 3C 3B 3A 39 38 37 36 35 34 33 32 31 30    ?>=<;:9876543210
00B7E0:  2F 2E 2D 2C 2B 2A 29 28 27 26 25 24 23 22 21 20    /.-,+*)('&%$#"! 
00B7F0:  1F 1E 1D 1C 1B 1A 19 18 17 16 15 14 13 12 11 10    ................
00B800:  0F 0E 0D 0C 0B 0A 09 08 07 06 05 04 03 02 01 00    ................
00B810:  FF 1A 00 00 61 64 F2 2C 1C FF 00 00 20 00 3C 00    ....ad.,.... .<.
00B820:  CB 20 22 70 63 2D 63 67 61 2E 67 77 65 22 2C 0D    . "pc-cga.gwe",.
00B830:  00 00 E2 2C 1C 00 90 2C 1C 91 00 00 00 00 1A AA    ...,...,........
00B840:  55 55 55 55 AA AA AA AA 55 55 55 55 AA AA AA AA    UUUU....UUUU....
00B850:  55 55 55 55 AA AA AA AA 55 55 55 55 AA AA AA AA    UUUU....UUUU....
00B860:  55 55 55 55 AA AA AA AA 55 55 55 55 AA AA AA AA    UUUU....UUUU....
00B870:  55 55 55 55 AA AA AA AA 55 55 55 55 AA AA AA AA    UUUU....UUUU....
00B880:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00B890:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00B8A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00B8B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00B8C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00B8D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00B8E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00B8F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00B900:  00 41 43 43 45 4E 54 53 20 44 41 54 00 00 00 00    .ACCENTS DAT....
00B910:  00 00 02 00 00 00 90 00 50 00 00 00 00 00 00 00    ........P.......
00B920:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00B930:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00B940:  50 00 00 2C 04 30 48 78 0C 7C CC 76 00 18 24 3C    P..,.0Hx.|.v..$<
00B950:  66 7E 60 3C 00 18 24 3C 18 18 18 3C 00 18 24 3C    f~`<..$<...<..$<
00B960:  66 66 66 3C 00 18 24 42 66 66 66 3E 00 6C 00 38    fff<..$Bfff>.l.8
00B970:  18 18 18 3C 00 6C 00 3C 66 7E 60 3C 00 66 00 66    ...<.l.<f~`<.f.f
00B980:  30 48 78 0C 7C CC 76 00 18 24 3C 66 7E 60 3C 00    0Hx.|.v..$<f~`<.
00B990:  18 24 3C 18 18 18 3C 00 18 24 3C 66 66 66 3C 00    .$<...<..$<fff<.
00B9A0:  18 24 42 66 66 66 3E 00 6C 00 38 18 18 18 3C 00    .$Bfff>.l.8...<.
00B9B0:  6C 00 3C 66 7E 60 3C 00 66 00 66 66 66 66 3E 00    l.<f~`<.f.ffff>.
00B9C0:  10 18 7C 7E 7C 18 10 00 08 18 3E 7E 3E 18 08 00    ..|~|.....>~>...
00B9D0:  1A 24 FF 00 FF 00 00 02 00 00 00 40 00 00 40 00    .$.........@..@.
00B9E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00B9F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00BA00:  00 47 57 44 45 4D 4F 20 20 42 49 4E 00 00 00 46    .GWDEMO  BIN...F
00BA10:  96 97 98 99 9A 9B 9C 9D 9E 00 00 00 00 00 00 00    ................
00BA20:  00 46 49 56 45 20 20 20 20 46 4E 54 00 00 00 07    .FIVE    FNT....
00BA30:  A0 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00BA40:  00 4C 49 4E 45 4F 55 54 20 46 4E 54 00 00 00 07    .LINEOUT FNT....
00BA50:  4F 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    O...............
00BA60:  00 47 57 2D 43 4C 49 50 20 53 43 52 00 00 00 80    .GW-CLIP SCR....
00BA70:  A3 A4 A5 A6 A7 A8 A9 AA AB AC AD AE AF B0 B1 B2    £...............
00BA80:  E5 41 43 43 45 4E 54 53 20 44 41 54 00 00 00 02    .ACCENTS DAT....
00BA90:  A2 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00BAA0:  00 47 57 2D 43 4C 49 50 20 53 43 52 01 00 00 01    .GW-CLIP SCR....
00BAB0:  B3 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00BAC0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BAD0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BAE0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BAF0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BB00:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00BB10:  00 00 00 00 00 40 C0 C0 C0 C0 C0 C0 C0 C0 C0 C0    .....@..........
00BB20:  C0 C0 C0 C0 C0 C0 C0 C0 C0 C0 C0 C0 C0 C0 C0 C0    ................
00BB30:  C0 C0 C0 C0 C0 C0 C0 C0 C0 C0 C0 C0 C0 C0 C0 C0    ................
00BB40:  C0 C0 C0 C0 C0 C0 C0 C0 C0 C0 C0 C0 C0 C0 C0 C0    ................
00BB50:  C0 C0 C0 C0 C0 C0 C0 C0 C0 C0 C0 C0 C0 C0 C0 C0    ................
00BB60:  1A 90 01 2C 0F 00 21 00 50 00 CB 20 22 66 72 61    ...,..!.P.. "fra
00BB70:  6D 65 2E 73 63 72 22 2C 0D 00 00 E2 2C 1C 00 C0    me.scr",....,...
00BB80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00BB90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00BBA0:  00 00 00 40 00 00 00 00 00 00 00 00 00 00 00 00    ...@............
00BBB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00BBC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00BBD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00BBE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 40 00 00    .............@..
00BBF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00BC00:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00BC10:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00BC20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00BC30:  00 00 00 00 00 00 00 40 00 00 00 00 00 00 00 00    .......@........
00BC40:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00BC50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00BC60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00BC70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00BC80:  00 40 00 00 00 00 00 00 00 00 00 00 00 00 00 00    .@..............
00BC90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00BCA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00BCB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00BCC0:  00 00 00 00 00 00 00 00 00 00 00 40 00 00 00 00    ...........@....
00BCD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00BCE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00BCF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00BD00:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BD10:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BD20:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BD30:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BD40:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BD50:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BD60:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BD70:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BD80:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BD90:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BDA0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BDB0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BDC0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BDD0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BDE0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BDF0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BE00:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BE10:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BE20:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BE30:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BE40:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BE50:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BE60:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BE70:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BE80:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BE90:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BEA0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BEB0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BEC0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BED0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BEE0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BEF0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00BF00:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
00BF10:  0A 00 01 00 02 09 4E E5 0A 00 C1 02 00 00 00 02    ......N.........
00BF20:  0A 00 C6 02 00 00 00 02 0A 00 C2 02 00 00 00 02    ................
00BF30:  0A 00 C7 02 00 00 00 02 0A 00 C3 02 00 00 00 02    ................
00BF40:  0A 00 C8 02 00 00 00 02 0A 00 C4 02 00 00 00 02    ................
00BF50:  0A 00 C9 02 00 00 00 02 0A 00 C5 02 00 00 00 02    ................
00BF60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00BF70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00BF80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00BF90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00BFA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00BFB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00BFC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00BFD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00BFE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00BFF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C000:  00 47 2D 57 20 20 20 20 20 47 57 4C 00 00 00 00    .G-W     GWL....
00C010:  00 00 02 00 00 00 80 00 E0 0D 00 00 00 00 00 00    ................
00C020:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C030:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C040:  E0 0D 00 B1 04 00 00 00 00 00 00 00 00 00 00 00    ................
00C050:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C060:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C070:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C080:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C090:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C0A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C0B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C0C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C0D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C0E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C0F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C100:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C110:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C120:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C130:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C140:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C150:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C160:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C170:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C180:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C190:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C1A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C1B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C1C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C1D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C1E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C1F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C200:  FF FF FF EC 00 00 10 FF EC 00 00 00 30 F0 F0 00    ............0...
00C210:  00 F0 F0 80 F0 F0 80 00 F0 F0 C0 00 00 10 F0 F0    ................
00C220:  80 00 00 30 F0 F0 F0 F0 10 F0 F0 F0 C0 00 00 00    ...0............
00C230:  00 70 F0 F0 F0 F0 F0 E0 00 30 F0 C0 00 F0 F0 30    .p.......0.....0
00C240:  F0 E0 00 00 70 F0 C0 00 00 F0 F0 F0 F0 E0 00 00    ....p...........
00C250:  10 F0 E0 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C260:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C270:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C280:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C290:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C2A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C2B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C2C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C2D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C2E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C2F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C300:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C310:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C320:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C330:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C340:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C350:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C360:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C370:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C380:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C390:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C3A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C3B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C3C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C3D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C3E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C3F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C400:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C410:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C420:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C430:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C440:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C450:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C460:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C470:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C480:  00 00 00 00 00 00 00 00 33 FF FF 88 00 FF FF 88    ........3.......
00C490:  FF FF 88 00 FF FF EE 00 33 FF C8 11 FF CE 77 FF    ........3.....w.
00C4A0:  EC 00 00 00 00 00 FF FF EE 00 00 00 FF FE 00 33    ...............3
00C4B0:  FF C8 00 FF EF 31 FF FF FF EE 00 33 FF EE 77 FF    .....1.....3..w.
00C4C0:  FF FF FF FF CC FF FF FF FF FF FF FF FF CC 00 00    ................
00C4D0:  00 00 CC 00 00 66 00 08 00 08 08 00 08 33 00 00    .....f.......3..
00C4E0:  11 88 02 00 40 10 00 02 04 00 20 00 10 FF CC 33    ....@..... ....3
00C4F0:  00 00 11 88 00 00 08 10 00 02 00 40 00 80 01 20    ...........@... 
00C500:  00 00 00 01 08 02 00 02 44 00 00 00 00 00 44 08    ........D.....D.
00C510:  00 00 00 00 00 00 00 03 00 00 00 11 00 00 00 01    ................
00C520:  00 08 00 08 08 00 08 44 00 00 00 44 02 00 40 10    .......D...D..@.
00C530:  00 02 04 00 20 00 20 00 04 44 00 00 00 04 00 00    .... . ..D......
00C540:  08 10 00 02 00 40 00 80 01 20 00 00 00 00 04 02    .....@... ......
00C550:  00 02 44 00 00 00 00 00 04 08 00 00 00 00 00 00    ..D.............
00C560:  00 00 08 00 00 02 00 00 00 00 08 08 00 08 08 00    ................
00C570:  08 08 00 00 00 02 02 00 40 10 00 02 04 00 20 00    ........@..... .
00C580:  40 00 08 08 00 00 00 02 00 00 08 10 00 02 00 40    @..............@
00C590:  00 80 01 20 00 00 00 00 02 02 00 02 04 00 00 00    ... ............
00C5A0:  00 00 04 08 00 00 00 00 00 00 00 00 04 00 00 02    ................
00C5B0:  00 00 00 00 08 08 00 08 08 00 08 08 00 00 00 02    ................
00C5C0:  02 00 40 10 00 02 04 00 20 00 80 01 00 08 00 00    ..@..... .......
00C5D0:  00 02 00 00 08 10 00 02 00 40 00 80 01 20 00 00    .........@... ..
00C5E0:  00 00 02 02 00 02 04 00 00 00 00 00 04 08 00 00    ................
00C5F0:  00 00 00 00 00 00 04 00 00 04 00 00 00 00 04 08    ................
00C600:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C610:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C620:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C630:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C640:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C650:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C660:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C670:  00 00 00 70 70 50 30 B0 80 50 D0 D0 D0 40 E0 E0    ...ppP0..P...@..
00C680:  70 70 70 00 80 80 B0 B0 A0 00 00 00 00 00 00 00    ppp.............
00C690:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C6A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C6B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 20 50 70    ............. Pp
00C6C0:  20 10 00 50 10 50 50 40 A0 80 40 50 50 10 70 40     ..P.PP@..@PP.p@
00C6D0:  A0 A0 A0 80 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C6E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C6F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C700:  00 00 00 00 00 00 00 20 50 50 30 10 10 50 90 10    ....... PP0..P..
00C710:  10 C0 A0 C0 50 70 70 10 40 40 B0 B0 B0 80 00 00    ....Ppp.@@......
00C720:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C730:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C740:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C750:  00 20 70 50 30 90 10 D0 D0 10 00 40 E0 80 70 40    . pP0......@..p@
00C760:  50 10 70 40 80 80 80 80 00 00 00 00 00 00 00 00    P.p@............
00C770:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C780:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C790:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C7A0:  00 00 00 00 00 00 00 00 00 00 00 00 80 80 00 00    ................
00C7B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C7C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C7D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C7E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C7F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00C800:  00 08 08 00 09 00 00 00 00 01 02 00 40 10 00 02    ............@...
00C810:  04 00 20 10 00 02 01 00 00 00 00 01 00 00 08 10    .. .............
00C820:  00 02 00 40 00 80 01 20 00 00 00 00 01 02 00 02    ...@... ........
00C830:  04 00 00 00 00 00 04 08 00 00 00 00 00 00 00 00    ................
00C840:  02 00 00 04 00 00 00 00 04 08 00 08 08 00 09 00    ................
00C850:  00 00 00 01 02 00 40 10 00 02 04 00 20 30 F0 84    ......@..... 0..
00C860:  01 00 00 00 00 01 00 00 08 10 00 02 00 40 00 80    .............@..
00C870:  01 20 00 00 00 00 10 02 00 02 04 00 00 00 00 00    . ..............
00C880:  04 80 00 00 00 00 00 00 00 00 20 00 00 24 A0 B0    .......... ..$..
00C890:  F0 F0 C0 58 50 80 D0 50 09 A0 B0 F0 A0 A1 12 50    ...XP..P.......P
00C8A0:  40 10 50 42 24 A0 A0 00 00 00 01 A0 A0 F0 F0 F0    @.PB$...........
00C8B0:  00 00 58 50 00 12 50 40 00 A0 A1 20 A0 F0 E0 A0    ..XP..P@... ....
00C8C0:  A1 12 50 60 70 F0 D0 50 70 F0 84 28 B0 F0 F0 F0    ..P`p..Pp..(....
00C8D0:  F0 F0 D0 50 42 00 00 14 50 40 00 00 00 28 A0 80    ...PB...P@...(..
00C8E0:  A0 A0 09 50 70 10 D0 41 02 A0 C0 10 A0 82 14 50    ...Pp..A.......P
00C8F0:  60 00 00 00 01 50 50 00 00 00 00 00 28 B0 00 02    `....PP.....(...
00C900:  A0 C0 00 D0 41 30 50 40 30 50 50 02 A0 A0 00 00    ....A0P@0PP.....
00C910:  24 A0 84 00 00 D0 50 00 00 00 00 00 60 A0 A0 00    $.....P.....`...
00C920:  00 24 A0 80 00 00 00 58 50 80 D0 50 09 A0 A0 00    .$.....XP..P....
00C930:  A0 A1 12 50 40 10 50 42 24 A0 A0 00 00 00 01 A0    ...P@.PB$.......
00C940:  A0 00 00 00 00 00 58 50 00 12 50 40 00 A0 A1 20    ......XP..P@... 
00C950:  A0 C0 20 A0 A1 12 50 60 00 00 14 50 04 00 00 28    .. ...P`...P...(
00C960:  B0 00 00 00 00 00 50 50 42 00 00 34 F0 80 00 00    ......PPB..4....
00C970:  00 78 F0 F3 F0 F0 09 F0 E0 00 F0 E1 12 F0 C0 10    .x..............
00C980:  F0 C2 34 F0 E0 00 00 00 01 F0 F0 00 00 00 00 00    ..4.............
00C990:  78 F0 00 12 F0 C0 00 F0 E1 30 F0 F3 FC F0 F0 12    x........0......
00C9A0:  F0 E0 00 00 34 F0 84 00 00 F0 F0 FF FF 88 37 FF    ....4.........7.
00C9B0:  F8 F0 E0 00 00 34 F0 80 00 00 00 F0 F0 F0 F0 F0    .....4..........
00C9C0:  81 F0 E0 00 F0 E1 12 F0 C0 10 F0 C2 34 F0 E0 00    ............4...
00C9D0:  00 00 01 F0 F0 F0 F0 00 00 00 78 F0 00 12 F0 C0    ..........x.....
00C9E0:  00 F0 E1 30 F0 F0 F0 F0 F0 30 F0 E0 00 00 34 F0    ...0.....0....4.
00C9F0:  84 00 00 F0 F0 F0 F0 88 74 F0 F0 F0 E0 00 00 34    ........t......4
00CA00:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00CA10:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00CA20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00CA30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00CA40:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00CA50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00CA60:  1A 01 1A 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00CA70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00CA80:  70 70 70 00 80 80 B0 B0 A0 00 00 00 00 00 00 00    ppp.............
00CA90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00CAA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00CAB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 20 50 70    ............. Pp
00CAC0:  20 10 00 50 10 50 50 40 A0 80 40 50 50 10 70 40     ..P.PP@..@PP.p@
00CAD0:  A0 A0 A0 80 00 00 00 00 00 00 00 00 00 00 00 00    ................
00CAE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00CAF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00CB00:  00 00 00 00 00 00 00 20 50 50 30 10 10 50 90 10    ....... PP0..P..
00CB10:  10 C0 A0 C0 50 70 70 10 40 40 B0 B0 B0 80 00 00    ....Ppp.@@......
00CB20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00CB30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00CB40:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00CB50:  00 20 70 50 30 90 10 D0 D0 10 00 40 E0 80 70 40    . pP0......@..p@
00CB60:  50 10 70 40 80 80 80 80 00 00 00 00 00 00 00 00    P.p@............
00CB70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00CB80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00CB90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00CBA0:  00 00 00 00 00 00 00 00 00 00 00 00 80 80 00 00    ................
00CBB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00CBC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00CBD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00CBE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00CBF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00CC00:  F0 08 13 FF 8C 78 F0 F0 F0 F0 09 F0 C2 00 78 E1    .....x........x.
00CC10:  12 F0 84 01 F0 C2 34 F0 C2 00 00 00 00 78 F0 F0    ......4......x..
00CC20:  F0 C0 00 00 78 E1 00 12 F0 84 00 78 E1 30 F0 F0    ....x......x.0..
00CC30:  F0 F0 F0 12 F0 E0 00 00 34 F0 84 00 00 F0 F0 F0    ........4.......
00CC40:  F0 08 34 F0 F0 F0 E0 00 00 34 F0 80 12 F0 84 F0    ..4......4......
00CC50:  F0 F0 F0 F0 81 F0 E0 00 F0 E1 12 F0 C0 10 F0 C2    ................
00CC60:  34 F0 E0 00 00 00 00 78 F0 F0 F0 E0 00 00 78 F0    4......x......x.
00CC70:  00 12 F0 C0 00 F0 E1 30 F0 F0 F0 F0 E0 30 F0 E0    .......0.....0..
00CC80:  00 00 70 F0 C0 00 00 F0 F0 F0 F0 08 34 F0 F0 F0    ..p.........4...
00CC90:  C0 00 00 70 F0 08 12 F0 C0 F0 F0 F0 F0 F0 18 F0    ...p............
00CCA0:  C2 00 78 F0 30 F0 84 01 F0 E0 70 F0 C2 00 00 00    ..x.0.....p.....
00CCB0:  00 34 F0 F0 F0 E0 00 00 F0 E1 00 12 F0 84 00 78    .4.............x
00CCC0:  F0 30 F0 F0 F0 F0 84 30 F0 E0 00 00 34 F0 84 00    .0.....0....4...
00CCD0:  00 F0 F0 F0 F0 08 34 F0 F0 F0 08 00 00 25 A5 08    ......4......%..
00CCE0:  21 A5 C0 D2 5A 5A 5A 5A 81 A5 86 00 2D A5 12 5A    !...ZZZZ....-..Z
00CCF0:  0C 01 5A 4A 25 A5 86 00 00 00 00 03 A5 A5 A5 B4    ..ZJ%...........
00CD00:  00 00 5A 4B 00 12 5A 48 00 2D A5 21 A5 A5 A5 A5    ..ZK..ZH.-.!....
00CD10:  A4 30 5A 68 00 00 61 A5 C0 00 00 A5 A5 A5 A5 08    .0Zh..a.........
00CD20:  16 5A 5A 5A 48 00 00 52 5A 08 12 5A 48 A5 A5 A5    .ZZZH..RZ..ZH...
00CD30:  A5 A5 90 5A 4A 00 5A 5A 21 A5 84 01 A5 A4 52 5A    ...ZJ.ZZ!.....RZ
00CD40:  4A 00 00 00 00 00 F0 F0 5A 5A 00 00 A5 A5 00 03    J.......ZZ......
00CD50:  A5 C0 00 5A 5A 30 5A 78 F0 5A 4A 21 A5 A4 00 00    ...ZZ0Zx.ZJ!....
00CD60:  52 5A 48 00 00 D2 5A F0 F0 80 34 F0 E1 A5 84 00    RZH...Z...4.....
00CD70:  00 25 A5 08 03 A5 C0 D2 5A F0 D2 5A 81 A5 86 00    .%......Z..Z....
00CD80:  2D A5 12 5A 0C 01 5A 4A 25 A5 86 00 00 00 00 00    -..Z..ZJ%.......
00CD90:  00 00 A5 B4 00 00 5A 4B 00 12 5A 48 00 2D A5 21    ......ZK..ZH.-.!
00CDA0:  A5 C0 10 A5 B4 30 5A 68 00 00 61 A5 C0 00 00 A5    .....0Zh..a.....
00CDB0:  B4 00 00 00 00 00 30 5A 68 00 00 43 0F 4C 47 0F    ......0Zh..C.LG.
00CDC0:  48 87 0F 80 87 0F 90 0F 1F 11 0F 1E 21 0F 2E 23    H...........!..#
00CDD0:  0F 2C 43 0F 1F 00 00 00 00 00 00 11 0F 1E 00 00    .,C.............
00CDE0:  87 0F 88 03 0F 48 11 0F 1E 21 0F 48 00 87 1E 21    .....H...!.H...!
00CDF0:  0F 2C 00 00 43 0F 48 00 00 87 1E 00 00 00 00 00    .,..C.H.........
00CE00:  00 47 57 44 45 4D 4F 20 20 42 49 4E 00 00 00 00    .GWDEMO  BIN....
00CE10:  00 00 02 00 00 FE 7E 00 2F 22 80 A0 00 00 00 00    ......~./"......
00CE20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00CE30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00CE40:  2F 22 00 1C 06 18 13 3D 20 06 23 46 23 AF 18 19    /".....= .#F#...
00CE50:  3D 20 10 7E 23 F5 7E 23 C6 54 4F 06 00 30 01 04    = .~#.~#.TO..0..
00CE60:  F1 18 06 7E 23 4E 23 46 23 E5 0B 62 6B 13 77 ED    ...~#N#F#..bk.w.
00CE70:  B0 E1 18 C6 1A 00 00 00 00 00 00 00 00 00 00 00    ................
00CE80:  20 59 43 72 6F 77 6E 43 72 75 6E 63 68 65 72 31     YCrownCruncher1
00CE90:  2E 30 00 00 53 F0 C4 01 09 09 57 65 6C 63 6F 6D    .0..S.....Welcom
00CEA0:  65 20 43 50 43 20 75 73 65 72 20 21 0D 0D 59 6F    e CPC user !..Yo
00CEB0:  75 20 65 6E 74 65 72 69 6E 67 20 74 68 65 20 6C    u entering the l
00CEC0:  61 73 74 20 47 50 41 20 70 72 6F 64 75 63 74 69    ast GPA producti
00CED0:  6F 6E 2C 0D 09 08 89 20 20 47 68 6F 75 6C 27 73    on,....  Ghoul's
00CEE0:  20 57 72 69 74 65 72 20 89 0D 0D 41 20 66 61 6E     Writer ...A fan
00CEF0:  74 61 73 74 69 63 20 75 74 69 6C 69 74 79 20 20    tastic utility  
00CF00:  77 68 69 63 68 20 61 6C 6C 6F 77 73 20 79 6F 75    which allows you
00CF10:  74 6F 20 63 72 65 61 74 65 20 20 73 65 6C 66 2D    to create  self-
00CF20:  65 78 65 63 75 74 61 62 6C 65 20 20 69 6E 74 72    executable  intr
00CF30:  6F 64 75 63 2D 74 69 6F 6E 73 20 77 69 74 68 6F    oduc-tions witho
00CF40:  75 74 20 20 61 6E 79 20 70 72 6F 67 72 61 6D 6D    ut  any programm
00CF50:  69 6E 67 20 21 20 20 59 6F 75 6A 75 73 74 20 68    ing !  Youjust h
00CF60:  61 76 65 20 74 6F 20 73 65 6C 65 63 74 20 61 6E    ave to select an
00CF70:  64 20 6C 6F 61 64 20 73 6F 6D 65 20 70 61 2D 72    d load some pa-r
00CF80:  61 6D 65 74 65 72 20 20 20 66 69 6C 65 73 2C 20    ameter   files, 
00CF90:  64 65 66 69 6E 65 20 20 6F 70 74 69 6F 6E 73 2C    define  options,
00CFA0:  20 61 6E 64 79 6F 75 72 20 69 6E 74 FD 09 59 59     andyour int..YY
00CFB0:  07 20 69 73 20 62 6F 72 6E FD 07 E3 59 43 20 6D    . is born...YC m
00CFC0:  61 6B 65 6E 69 63 65 20 70 61 69 6E 74 69 6E 67    akenice painting
00CFD0:  73 2C 20 20 63 6F 6D 70 6F 73 65 20 20 67 72 65    s,  compose  gre
00CFE0:  61 74 20 74 75 6E 65 73 6F 6E 20 63 70 63 2C 20    at tuneson cpc, 
00CFF0:  20 68 6F 77 20 6C 75 63 6B 79 20 79 6F 75 20 61     how lucky you a
00D000:  10 0F 2C 00 00 43 0F 3F 8F 0F 48 87 0F 80 87 0F    ..,..C.?..H.....
00D010:  90 0F 0F EF 0F 1E 21 0F 1F CF 0F 2C 43 0F 0F FF    ......!....,C...
00D020:  FF FE 10 FF FF EF 0F 1E 00 00 87 0F 7F CF 0F 1F    ................
00D030:  EF 0F 1E 21 0F 48 00 87 1E 21 0F 2C 00 00 43 0F    ...!.H...!.,..C.
00D040:  48 00 00 87 1E FF FF EC 00 00 10 0F 2C 00 00 43    H...........,..C
00D050:  0F 0F 0F 0F 48 87 0F 80 87 0F 90 0F 0F 0F 0F 1E    ....H...........
00D060:  21 0F 0F 0F 0F 2C 43 0F 0F 0F 0F 1E 10 0F 0F 0F    !....,C.........
00D070:  0F 1E 00 00 87 0F 0F 0F 0F 0F 0F 0F 1E 21 0F 48    .............!.H
00D080:  00 87 1E 21 0F 2C 00 00 43 0F 48 00 00 87 0F 0F    ...!.,..C.H.....
00D090:  0F 2C 00 00 10 0F 2C 00 00 63 AF AF AF AF 80 D7    .,....,..c......
00D0A0:  5F 80 D7 5F 90 AF AF AF AF BE 31 5F 5F 5F 5F 6C    _.._......1____l
00D0B0:  63 AF AF AF AF BE 10 AF AF AF AF AC 00 00 D7 5F    c.............._
00D0C0:  5F 5F 5F 5F 2F AF BE 21 AF C8 00 A7 BE 31 5F 6C    ____/..!.....1_l
00D0D0:  00 00 43 0F 48 00 00 D7 5F 5F 5F 6C 00 00 10 5F    ..C.H...___l..._
00D0E0:  6C 00 00 31 5F 5F 5F 5F 80 A7 AF 80 A7 AF 80 D7    l..1____........
00D0F0:  5F 5F 5F 6C 10 AF AF AF AF C8 31 5F 5F 5F 5F 5E    ___l......1____^
00D100:  10 5F 5F 5F 5F 6C 00 00 63 AF AF AF AF AF DF 5F    .____l..c......_
00D110:  6C 31 5F 48 00 D7 5E 21 AF AC 00 00 63 AF C8 00    l1_H..^!....c...
00D120:  00 A7 AF AF AF AC 00 00 10 AF AC 00 00 31 FF FF    .............1..
00D130:  FF FE 00 F7 FF 80 F7 FF 80 F7 FF FF FF EC 10 FF    ................
00D140:  FF FF FF C8 31 FF FF FF FF FE 10 FF FF FF FF C8    ....1...........
00D150:  00 00 73 FF FF FF FF FF FF FF EC 31 FF C8 00 F7    ..s........1....
00D160:  FE 31 FF EC 00 00 73 FF C8 00 00 F7 FF FF FF EC    .1....s.........
00D170:  00 00 10 FF EC 00 00 10 FF FF FF EC 00 F7 FF 80    ................
00D180:  F7 FF 80 73 FF FF FF C8 00 F7 FF FF FF 80 10 FF    ...s............
00D190:  FF FF FF FE 10 FF FF FF FF 80 00 00 31 FF FF FF    ............1...
00D1A0:  FF FF FF FF C8 31 FF C8 00 F7 FE 31 FF EC 00 00    .....1.....1....
00D1B0:  73 FF C8 00 00 F7 FF FF FF EC 00 00 10 FF EC 00    s...............
00D1C0:  00 00 F3 FF FF C0 00 F7 FF 80 F7 FF 80 30 FF FF    .............0..
00D1D0:  FE 80 00 71 FF FF FC 00 00 F3 FF FF FF FE 10 FF    ...q............
00D1E0:  FF FF FC 00 00 00 10 F7 FF FF FF FF FF FE 80 31    ...............1
00D1F0:  FF C8 00 F7 FE 31 FF EC 00 00 73 FF C8 00 00 F7    .....1....s.....
00D200:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
00D210:  0B 00 01 00 02 09 4E E5 0B 00 C1 02 00 00 00 02    ......N.........
00D220:  0B 00 C6 02 00 00 00 02 0B 00 C2 02 00 00 00 02    ................
00D230:  0B 00 C7 02 00 00 00 02 0B 00 C3 02 00 00 00 02    ................
00D240:  0B 00 C8 02 00 00 00 02 0B 00 C4 02 00 00 00 02    ................
00D250:  0B 00 C9 02 00 00 00 02 0B 00 C5 02 00 00 00 02    ................
00D260:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00D270:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00D280:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00D290:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00D2A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00D2B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00D2C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00D2D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00D2E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00D2F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00D300:  72 65 FD 08 4D 5A 12 63 61 6E 69 6E 63 6C 75 64    re..MZ.caninclud
00D310:  65 20 20 74 68 65 6D 20 69 6E FD 10 67 59 47 2C    e  them in..gYG,
00D320:  20 20 74 6F 67 69 76 65 20 20 61 20 6D 6F 72 65      togive  a more
00D330:  20 20 70 65 72 73 6F 6E 61 6C 20 74 6F 75 63 68      personal touch
00D340:  20 20 74 6F 20 79 6F 75 72 69 6E 74 72 6F 73 20      to yourintros 
00D350:  21 20 20 49 73 20 69 74 20 74 68 65 20 62 65 73    !  Is it the bes
00D360:  74 20 63 70 63 20 77 FD 06 72 59 33 3F 57 65 6C    t cpc w..rY3?Wel
00D370:  6C 2C 20 6A 75 73 74 20 74 72 79 20 69 74 20 21    l, just try it !
00D380:  0D 09 08 89 20 47 2E 57 2E 20 69 73 20 53 48 41    .... G.W. is SHA
00D390:  52 45 57 41 52 45 20 89 0D 0D 09 04 57 61 72 6E    REWARE .....Warn
00D3A0:  FD 06 E0 59 03 57 61 72 6E FD 06 E0 59 FD 09 41    ...Y.Warn...Y..A
00D3B0:  5B 01 0D 0D FD 07 B5 5A FD 08 09 5B 04 20 69 73    [......Z...[. is
00D3C0:  20 61 FD 0B 31 5B 36 20 20 70 72 6F 2D 67 72 61     a..1[6  pro-gra
00D3D0:  6D 2E 20 49 74 20 6D 65 61 6E 73 20 74 68 61 74    m. It means that
00D3E0:  20 69 66 20 79 6F 75 20 75 73 65 20 69 74 20 72     if you use it r
00D3F0:  65 2D 67 75 6C 61 72 6C 79 2C 20 79 6F 75 FD 0B    e-gularly, you..
00D400:  EE 59 F0 23 6E 64 20 79 6F 75 72 20 75 73 65 72    .Y.#nd your user
00D410:  27 73 63 6F 6E 74 72 69 62 75 74 69 6F 6E 20 3A    'scontribution :
00D420:  0D 0D 09 06 87 20 31 30 20 44 65 75 74 73 63 68    ..... 10 Deutsch
00D430:  6D 61 72 6B 0D 09 06 87 20 33 30 20 66 72 65 6E    mark.... 30 fren
00D440:  63 68 20 46 72 61 6E 63 73 0D 09 06 87 20 36 20    ch Francs.... 6 
00D450:  55 2E 53 20 44 6F 6C 6C 61 72 73 20 6F 72 20 33    U.S Dollars or 3
00D460:  20 50 6F 75 6E 64 73 0D 0D 09 02 24 20 54 6F 20     Pounds....$ To 
00D470:  72 65 67 69 73 74 65 72 FD 06 16 5B FD 06 67 5B    register...[..g[
00D480:  48 20 74 6F 20 3A 20 24 0D 0D 09 06 4D 6F 6E 63    H to : $....Monc
00D490:  68 61 74 72 65 20 48 65 72 76 65 0D 09 06 43 6F    hatre Herve...Co
00D4A0:  6C 6C 65 67 65 2C 20 31 20 72 75 65 20 64 65 73    llege, 1 rue des
00D4B0:  20 6F 72 6D 65 73 0D 09 06 34 35 33 32 30 20 43     ormes...45320 C
00D4C0:  6F 75 72 74 65 6E 61 79 20 20 FD 06 FF 5B 14 65    ourtenay  ...[.e
00D4D0:  0D 09 0B 89 20 47 72 65 65 74 69 6E 67 73 20 89    .... Greetings .
00D4E0:  0D 0D 0D 49 FD 07 36 5C 11 6F 75 6C 64 20 6C 69    ...I..6\.ould li
00D4F0:  6B 65 20 74 6F 20 67 72 65 65 74 FD 09 2C 5C 2F    ke to greet..,\/
00D500:  E1 66 FD 0E E1 66 43 A4 67 00 BC 67 00 D6 67 00    .f...fC.g..g..g.
00D510:  D6 67 00 A4 67 00 F8 67 00 D6 67 00 10 68 00 30    .g..g..g..g..h.0
00D520:  68 00 52 68 00 52 68 00 A2 68 00 DB 68 00 17 69    h.Rh.Rh..h..h..i
00D530:  00 17 69 00 40 69 00 01 6A 80 02 67 00 C2 6A 00    ..i.@i..j..g..j.
00D540:  17 6B 00 6C 6B 00 6C 6B 00 17 6B FD 07 3B 67 31    .k.lk.lk..k..;g1
00D550:  CF 6B 00 30 6C 00 85 6C 00 DA 6C 00 3B 6D 00 DA    .k.0l..l..l.;m..
00D560:  6C 00 DA 6C 00 DA 6C 00 DA 6C 00 9C 6D 80 38 67    l..l..l..l..m.8g
00D570:  00 F1 6D 00 F1 6D 00 33 6E 00 33 6E 00 85 6E 00    ..m..m.3n.3n..n.
00D580:  DE 6E FD 0A 74 67 31 85 6E 00 37 6F 00 89 6F 00    .n..tg1.n.7o..o.
00D590:  89 6F 00 DB 6F 00 DB 6F 00 2F 70 00 32 70 80 6E    .o..o..o./p.2p.n
00D5A0:  67 46 04 00 48 82 49 86 4B 82 49 88 48 8A 44 84    gF..H.I.K.I.H.D.
00D5B0:  46 82 48 86 49 82 46 92 FF FD 15 A4 67 19 4D 8E    F.H.I.F.....g.M.
00D5C0:  50 84 FF 52 0C 00 D0 00 4D 83 50 82 4D 82 4B 82    P..R....M.P.M.K.
00D5D0:  4D 86 CD 00 50 83 52 8C FD 0B D9 67 00 8A FD 17    M...P.R....g....
00D5E0:  BB 67 F0 0A 92 FF 4D 04 00 4E 82 50 86 52 82 50    .g....M..N.P.R.P
00D5F0:  86 4E 82 4D 86 4E 82 4D 88 4B 82 4E 82 4D 82 CB    .N.M.N.M.K.N.M..
00D600:  00 4D 83 49 90 FF 4D 04 00 50 82 52 86 54 82 55    .M.I..M..P.R.T.U
00D610:  8C 57 82 59 82 59 86 57 82 55 84 57 84 54 86 55    .W.Y.Y.W.U.W.T.U
00D620:  82 54 84 50 84 4D 82 FF 4D 02 00 C6 00 4B 82 C6    .T.P.M..M....K..
00D630:  00 49 82 C6 00 48 82 C6 00 49 82 4B 82 4D 82 FD    .I...H...I.K.M..
00D640:  13 55 68 12 82 C4 00 4B 82 C4 00 49 82 C4 00 48    .Uh....K...I...H
00D650:  82 C4 00 49 82 4B 82 FD 0C 7F 68 49 46 82 C4 00    ...I.K....hIF...
00D660:  48 84 FF 46 02 00 49 82 4D 82 4B 86 49 84 46 82    H..F..I.M.K.I.F.
00D670:  52 02 01 52 82 D2 01 52 82 52 82 D2 01 52 84 4D    R..R...R.R...R.M
00D680:  02 00 50 82 55 82 54 86 50 84 50 82 50 02 01 50    ..P.U.T.P.P.P..P
00D690:  82 D0 01 50 82 50 82 D0 01 50 84 FF C9 00 C8 00    ...P.P...P......
00D6A0:  C6 00 C4 00 46 86 FD 07 A5 68 06 82 46 82 D2 01    ....F....h..F...
00D6B0:  52 82 FD 06 B2 68 FD 08 DB 68 F0 AF 41 86 44 82    R....h...h..A.D.
00D6C0:  49 82 48 86 44 82 44 82 50 02 01 D0 01 50 83 50    I.H.D.D.P....P.P
00D6D0:  82 FF 46 04 B0 00 48 02 00 49 86 4B 82 4D 86 49    ..F...H..I.K.M.I
00D6E0:  82 50 84 4D 85 CA F0 00 4B 82 4D 04 00 4D 89 C8    .P.M....K.M..M..
00D6F0:  00 49 02 F0 00 4B 04 00 4B 8A FF D2 B0 00 D2 B0    .I...K..K.......
00D700:  65 64 75 73 65 72 73 20 6F 66 20 4D 75 6C 74 69    edusers of Multi
00D710:  20 4D 61 72 6B 20 31 2E 30 2C 20 20 61 6E 6F 74     Mark 1.0,  anot
00D720:  68 65 72 20 47 50 41 73 68 61 72 65 77 61 72 65    her GPAshareware
00D730:  FD 09 86 59 27 21 20 54 68 65 79 20 61 72 65 20    ...Y'! They are 
00D740:  6F 6E 6C 79 20 37 20 21 0D 09 02 89 20 41 6E 74    only 7 !.... Ant
00D750:  6F 69 6E 65 20 50 69 74 72 6F 75 20 28 FD 08 18    oine Pitrou (...
00D760:  5D 27 6F 66 20 4D 4D 50 46 29 0D 09 02 89 20 47    ]'of MMPF).... G
00D770:  65 72 65 79 20 59 76 65 73 20 28 4D 61 64 72 61    erey Yves (Madra
00D780:  6D 20 6F 66 20 42 65 6E 67 21 FD 06 37 5D 15 44    m of Beng!..7].D
00D790:  72 75 65 6C 6C 65 20 42 65 72 6E 61 72 64 20 28    ruelle Bernard (
00D7A0:  42 65 62 65 72 FD 06 58 5D 14 43 61 79 72 69 65    Beber..X].Cayrie
00D7B0:  72 20 53 65 72 67 65 20 28 53 69 72 69 75 73 FD    r Serge (Sirius.
00D7C0:  07 74 5D 29 68 6F 74 61 72 64 20 44 61 76 69 64    .t])hotard David
00D7D0:  0D 09 02 89 20 4D 69 74 65 72 6D 69 74 65 20 4D    .... Mitermite M
00D7E0:  69 63 68 65 6C 20 28 4D 61 6E 64 65 6C 61 FD 06    ichel (Mandela..
00D7F0:  8F 5D 40 42 72 75 6E 6F 20 44 69 64 69 65 72 20    .]@Bruno Didier 
00D800:  28 43 68 72 6F 6E 6F 73 29 0D 0D 53 6F 2C 20 6C    (Chronos)..So, l
00D810:  65 74 27 73 20 74 72 79 20 74 6F 20 62 65 61 74    et's try to beat
00D820:  20 74 68 69 73 20 72 65 63 6F 72 64 20 28 3F 29     this record (?)
00D830:  77 69 74 68 FD 11 B4 5A 29 52 45 47 49 53 54 45    with...Z)REGISTE
00D840:  52 20 21 0D 0D 09 0A 89 20 57 68 61 74 20 69 73    R !..... What is
00D850:  20 47 50 41 20 3F 20 89 0D 0D 0D 47 50 41 20 69     GPA ? ....GPA i
00D860:  73 20 61 FD 08 F8 5B 2A 67 72 6F 75 70 20 6F 66    s a...[*group of
00D870:  20 63 6F 64 65 72 73 2E 20 54 68 65 79 68 61 76     coders. Theyhav
00D880:  65 20 6D 61 64 65 20 64 65 6D 6F 73 20 28 4D 6F    e made demos (Mo
00D890:  6E 73 74 FD 07 CB 5C 34 74 68 65 20 64 61 72 6B    nst...\4the dark
00D8A0:  6E 65 73 73 2C 20 47 2E 59 20 39 30 2C 20 47 50    ness, G.Y 90, GP
00D8B0:  41 20 64 65 6D 6F 20 33 2C 20 20 4D 75 73 69 63    A demo 3,  Music
00D8C0:  20 50 61 63 6B 31 20 74 6F 20 34 29 2C FD 06 B6     Pack1 to 4),...
00D8D0:  5B F0 35 63 72 61 63 6B 65 64 20 20 20 67 61 6D    [.5cracked   gam
00D8E0:  65 73 20 20 69 6E 20 74 68 65 70 61 73 74 20 28    es  in thepast (
00D8F0:  6E 61 73 74 79 20 62 6F 79 73 29 2E 20 20 20 4D    nasty boys).   M
00D900:  01 D2 B0 01 D2 B0 02 D2 B0 02 D2 B0 03 D2 B0 03    ................
00D910:  D2 B0 03 D2 B0 03 D2 B0 04 D2 B0 04 D2 B0 04 D2    ................
00D920:  B0 05 D2 B0 05 D2 B0 05 D2 B0 05 CD B0 00 CD B0    ................
00D930:  00 CD B0 01 CD B0 01 CD B0 02 CD B0 02 CD B0 03    ................
00D940:  CD B0 03 CD B0 04 CD B0 04 CD B0 05 CD B0 05 CD    ................
00D950:  B0 06 CD B0 06 CD B0 07 CD B0 07 CB B0 00 CB B0    ................
00D960:  00 CB B0 01 CB B0 01 CB B0 02 CB B0 02 CB B0 03    ................
00D970:  CB B0 03 CB B0 04 CB B0 04 CB B0 05 CB B0 05 CB    ................
00D980:  B0 06 CB B0 06 CB B0 07 CB B0 07 D0 B0 00 D0 B0    ................
00D990:  00 D0 B0 01 D0 B0 01 D0 B0 02 D0 B0 02 D0 B0 03    ................
00D9A0:  D0 B0 03 D0 B0 04 D0 B0 04 D0 B0 05 D0 B0 05 D0    ................
00D9B0:  B0 06 D0 B0 06 D0 B0 07 D0 B0 07 FF FD 2D 73 69    .............-si
00D9C0:  02 CD B0 08 FD 2D A3 69 02 CB B0 08 FD 30 01 6A    .....-£i.....0.j
00D9D0:  23 C9 B0 00 C9 B0 01 C9 B0 01 C9 B0 02 C9 B0 02    #...............
00D9E0:  C9 B0 03 C9 B0 03 C9 B0 04 C9 B0 04 C9 B0 05 C9    ................
00D9F0:  B0 05 C9 B0 06 FD 0C 31 6A 39 FF 46 02 F1 01 46    .......1j9.F...F
00DA00:  02 01 46 82 C6 01 46 82 46 82 C6 01 46 82 46 82    ..F...F.F...F.F.
00DA10:  44 02 F1 02 44 02 01 44 82 C4 01 44 82 44 82 C4    D...D..D...D.D..
00DA20:  01 44 82 44 82 41 02 F1 01 41 02 01 C1 01 41 82    .D.D.A...A....A.
00DA30:  41 82 41 82 FD 06 F3 6A 0E 42 02 F1 02 42 02 01    A.A....j.B...B..
00DA40:  C2 01 42 82 42 82 42 82 FD 06 08 6B FD 4F C1 6A    ..B.B.B....k.O.j
00DA50:  FD 06 5D 6B 03 FF 46 02 F2 FD 08 1A 6B 06 C6 01    ..]k..F.....k...
00DA60:  C6 02 46 02 01 FD 08 26 6B 00 F2 FD 08 2F 6B 06    ..F....&k..../k.
00DA70:  C4 01 C4 02 44 02 01 FD 08 3B 6B 00 F2 FD 08 44    ....D....;k....D
00DA80:  6B 06 C1 01 C1 02 41 02 01 FD 08 50 6B 00 F2 FD    k.....A....Pk...
00DA90:  08 59 6B 02 C2 01 C2 FD 07 B7 6B 04 02 02 42 02    .Yk.......k...B.
00DAA0:  01 FD 5B 6B 6B FD 1C 10 6B 23 4B 02 F1 01 4B 02    ..[kk...k#K...K.
00DAB0:  01 4B 82 CB 01 4B 82 4B 82 CB 01 4B 82 4B 82 49    .K...K.K...K.K.I
00DAC0:  02 F1 02 49 02 01 C9 01 49 82 49 82 49 82 FD 06    ...I....I.I.I...
00DAD0:  61 6C 13 48 02 F1 03 48 02 01 C8 01 48 82 48 82    al.H...H....H.H.
00DAE0:  48 82 C8 01 48 82 48 FD 54 2E 6C 00 48 FD 14 6A    H...H.H.T.l.H..j
00DAF0:  6B FD 08 94 6C 00 F2 FD 08 9D 6C 06 CB 01 CB 02    k...l.....l.....
00DB00:  6F 73 74 20 6F 66 20 47 50 41 20 67 75 79 73 61    ost of GPA guysa
00DB10:  72 65 20 6E 6F 77 20 6F 6E 20 50 43 2C 20 20 62    re now on PC,  b
00DB20:  75 74 20 6D 65 2C 20 54 6F 6D 20 65 74 20 4A 65    ut me, Tom et Je
00DB30:  72 72 79 2C 73 74 69 6C 6C 20 73 75 70 70 6F 72    rry,still suppor
00DB40:  74 73 20 43 50 43 20 63 6F 6D 70 75 74 65 72 2E    ts CPC computer.
00DB50:  20 20 4D 79 20 6C 61 73 74 FD 07 D8 59 21 73 20      My last...Y!s 
00DB60:  61 72 65 20 44 65 6D 69 6E 65 75 72 2C 20 61 20    are Demineur, a 
00DB70:  6C 69 74 74 6C 65 20 67 61 6D 65 2C 61 6E 64 20    little game,and 
00DB80:  FD 06 D1 5C 0D 2D 4D 61 72 6B 2C 20 74 68 65 20    ...\.-Mark, the 
00DB90:  66 69 72 FD 07 51 59 05 73 68 61 72 65 2D FD 0C    fir..QY.share-..
00DBA0:  F3 5C 05 2E 0D 0D 4E 65 77 FD 06 7C 5F 14 6F 66    .\....New..|_.of
00DBB0:  74 77 61 72 65 20 70 72 6F 6A 65 63 74 73 20 21    tware projects !
00DBC0:  20 20 41 FD 07 55 5F 15 64 65 6D 6F 20 61 6E 64      A..U_.demo and
00DBD0:  20 61 20 6E 65 77 20 72 65 6C 65 61 73 65 FD 0E     a new release..
00DBE0:  CE 5C 0E 2E 43 6F 6D 69 6E 67 20 73 6F 6F 6E 20    .\..Coming soon 
00DBF0:  6F 6E FD 06 C3 5B F0 42 73 63 72 65 65 6E 73 2E    on...[.Bscreens.
00DC00:  2E 2E 0D 0A C3 0B 60 C3 93 60 C3 77 60 66 04 06    ......`..`.w`f..
00DC10:  03 DD 21 DA 63 FD 21 06 63 11 1C 00 C5 DD 36 06    ..!.c.!.c.....6.
00DC20:  01 DD 72 09 DD 72 1B DD 36 05 10 FD 6E 00 FD 66    ..r..r..6...n..f
00DC30:  01 7E DD 77 08 23 4E 23 46 23 DD 75 0C DD 74 0D    .~.w.#N#F#.u..t.
00DC40:  DD 71 00 DD 70 01 DD 19 FD 23 FD 23 C1 10 CD 3E    .q..p....#.#...>
00DC50:  06 32 BB 60 7A 32 CF 60 3C 32 B6 60 3E 38 32 C0    .2.`z2.`<2.`>82.
00DC60:  60 3E FF 32 02 63 32 03 63 32 04 63 32 05 63 3E    `>.2.c2.c2.c2.c>
00DC70:  0C 4A CD E4 62 3E 0D 4A C3 E4 62 3E 07 0E 3F CD    .J..b>.J..b>..?.
00DC80:  E4 62 3E 08 0E 00 CD E4 62 3E 09 FD 06 80 60 44    .b>.....b>....`D
00DC90:  0A 0E 00 C3 E4 62 21 B6 60 35 DD 21 DA 63 01 E8    .....b!.`5.!.c..
00DCA0:  63 CD 49 61 DD 21 F6 63 01 04 64 CD 49 61 DD 21    c.Ia.!.c..d.Ia.!
00DCB0:  12 64 01 20 64 CD 49 61 3E 01 B7 20 05 3E 06 32    .d. d.Ia>.. .>.2
00DCC0:  B6 60 3E 38 21 03 63 BE 28 07 77 4F 3E 07 CD E4    .`>8!.c.(.wO>...
00DCD0:  62 3E 06 21 02 FD 07 C3 60 07 06 CD E4 62 3E 00    b>.!....`....b>.
00DCE0:  21 04 FD 07 D2 60 00 0B FD 06 DA 60 1D 05 63 BE    !....`.....`..c.
00DCF0:  C8 77 4F 3E 0D C3 E4 62 23 46 DD 70 06 23 DD 75    .wO>...b#F.p.#.u
00DD00:  4B 02 01 FD 08 A9 6C 00 F2 FD 08 B2 6C 06 C9 01    K.....l.....l...
00DD10:  C9 02 49 02 01 FD 08 BE 6C 00 F2 FD 08 C7 6C 06    ..I.....l.....l.
00DD20:  C8 01 C8 02 48 02 01 FD 5E D3 6C FD 08 C8 6C FD    ....H...^.l...l.
00DD30:  57 15 6B 0A 22 02 01 2E 82 22 82 2E 82 22 82 FD    W.k."...."..."..
00DD40:  06 F4 6D 06 2C 82 38 82 2C 82 38 FD 07 01 6E 08    ..m.,.8.,.8...n.
00DD50:  38 82 29 82 35 82 29 82 35 FD 07 11 6E 08 35 82    8.).5.).5...n.5.
00DD60:  2A 82 36 82 2A 82 36 FD 07 21 6E 00 36 FD 08 EF    *.6.*.6..!n.6...
00DD70:  6D 06 02 03 2E 02 01 22 82 FD 08 36 6E 07 2C 82    m......"...6n.,.
00DD80:  38 82 2C 02 03 38 FD 09 46 6E 0A 38 02 01 29 82    8.,..8..Fn.8..).
00DD90:  35 82 29 02 03 35 FD 09 5A 6E 0A 35 02 01 2A 82    5.)..5..Zn.5..*.
00DDA0:  36 82 2A 02 03 36 FD 09 6E 6E 03 36 02 01 FF FD    6.*..6..nn.6....
00DDB0:  06 99 68 01 46 82 FD 07 85 6E 00 82 FD 08 85 6E    ..h.F....n.....n
00DDC0:  FD 12 85 6E 09 C6 00 C1 00 44 82 C1 00 44 82 FD    ...n.....D...D..
00DDD0:  07 B1 6E 00 82 FD 08 B1 6E FD 12 B1 6E 01 C4 00    ..n.....n...n...
00DDE0:  FD 58 84 6E 00 00 FD 16 32 6E 07 27 82 33 82 27    .X.n....2n.'.3.'
00DDF0:  02 03 33 FD 09 4A 6F 00 33 FD 14 5A 6E FD 16 46    ..3..Jo.3..Zn..F
00DE00:  6E FD 3C 36 6F FD 16 46 6E 07 FF 22 02 F1 00 2E    n.<6o..Fn.."....
00DE10:  02 01 FD 4D 8E 6F 05 00 40 FF 00 40 FF F3 D3 0F    ...M.o..@..@....
00DE20:  07 33 FF FF 88 00 FF FF 88 FD 06 09 80 0A EE 00    .3..............
00DE30:  33 FF C8 11 FF CE 77 FF EC 52 02 FF FF EE 50 0A    3.....w..R....P.
00DE40:  FF FE 00 33 FF C8 00 FF EF 31 FF FD 06 14 80 01    ...3.....1......
00DE50:  EE 77 A1 FF 00 CC A4 FF 00 CC 51 2D CC 00 00 66    .w........Q-...f
00DE60:  00 08 00 08 08 00 08 33 00 00 11 88 02 00 40 10    .......3......@.
00DE70:  00 02 04 00 20 00 10 FF CC 33 00 00 11 88 00 00    .... ....3......
00DE80:  08 10 00 02 00 40 00 80 01 20 50 05 01 08 02 00    .....@... P.....
00DE90:  02 44 52 01 44 08 54 00 03 50 00 11 50 00 01 FD    .DR.D.T..P..P...
00DEA0:  07 56 80 00 44 50 00 44 FD 0A 62 80 03 20 00 04    .V..DP.D..b.. ..
00DEB0:  44 50 00 04 FD 0C 74 80 51 04 04 02 00 02 44 52    DP....t.Q.....DR
00DEC0:  01 04 08 55 03 08 00 00 02 51 00 08 FD 06 A1 80    ...U.....Q......
00DED0:  00 08 50 00 02 FD 0A AC 80 03 40 00 08 08 50 00    ..P.......@...P.
00DEE0:  02 FD 0C BE 80 51 04 02 02 00 02 04 52 01 04 08    .....Q......R...
00DEF0:  55 03 04 00 00 02 51 FD 08 EA 80 50 FD 0B F5 80    U.....Q....P....
00DF00:  00 DD 74 01 C3 FA 61 23 7E DD 77 FD 08 FE 60 26    ..t...a#~.w...`&
00DF10:  AF DD 77 17 DD 77 15 4F DD 7E 04 C3 E4 62 DD 36    ..w..w.O.~...b.6
00DF20:  0A 00 DD 6E 0C DD 66 0D 7E FE 80 20 06 23 5E 23    ...n..f.~.. .#^#
00DF30:  56 EB 7E 23 5E 23 56 FD 08 35 60 F0 2B 77 08 EB    V.~#^#V..5`.+w..
00DF40:  18 13 3A B6 60 B7 C2 FA 61 DD 35 06 C2 FA 61 DD    ..:.`...a.5...a.
00DF50:  6E 00 DD 66 01 7E B7 28 9A FE FE 28 A5 FE FF 28    n..f.~.(...(...(
00DF60:  BB 16 00 E6 7F D6 0A DD 86 08 DD 77 07 87 5F E5    ...........w.._.
00DF70:  21 0C 63 19 7E DD 77 18 23 7E DD 77 19 E1 3E 01    !.c.~.w.#~.w..>.
00DF80:  CB 7E 20 0D 23 7E CB 7F 28 07 E6 7F DD 77 06 18    .~ .#~..(....w..
00DF90:  53 DD 77 06 23 E5 7E F5 E6 0F DD BE 05 28 06 DD    S.w.#.~......(..
00DFA0:  77 05 DD 72 0A 87 87 87 5F 21 42 64 19 50 59 ED    w..r...._!Bd.PY.
00DFB0:  A0 ED A0 ED A0 ED A0 ED A0 FD 06 B6 61 24 F1 E1    ............a$..
00DFC0:  E6 F0 28 1F FE F0 CA A0 62 FE D0 CA BC 62 FE B0    ..(.....b....b..
00DFD0:  CA C4 62 FE 80 D2 CC 62 FE 10 20 07 AF DD 77 1B    ..b....b.. ...w.
00DFE0:  DD 77 09 FD 07 0E 61 3D DD 36 16 00 DD 36 17 20    .w....a=.6...6. 
00DFF0:  DD 7E 17 B7 20 0E DD 7E 15 B7 C8 DD 77 17 DD 7E    .~.. ..~....w..~
00E000:  14 DD 77 16 16 00 DD 5E 16 DD 34 16 DD 35 17 DD    ..w....^..4..5..
00E010:  7E 1B B7 28 1A 67 DD 6E 1A 19 7E DD 46 07 80 87    ~..(.g.n..~.F...
00E020:  42 4F 21 0C 63 09 FD 09 7B 61 F0 4B DD 66 0F DD    BO!.c...{a.K.f..
00E030:  6E 0E 19 19 4E 23 46 DD 6E 18 DD 66 19 09 4D DD    n...N#F.n..f..M.
00E040:  7E 02 CD E4 62 4C DD 7E 03 CD E4 62 DD 66 11 DD    ~...bL.~...b.f..
00E050:  6E 10 19 7E CB 7F 20 12 E6 0F DD 96 0A 30 01 AF    n..~.. ......0..
00E060:  DD B6 09 4F DD 7E 04 CD E4 62 DD 6E 12 DD 66 13    ...O.~...b.n..f.
00E070:  19 7E CB 7F C0 E6 1F DD 46 0B 4F B7 78 28 08 47    .~......F.O.x(.G
00E080:  79 32 CF 60 78 D6 40 32 9B 62 3A C0 60 CB EF 32    y2.`x.@2.b:.`..2
00E090:  C0 60 C9 23 7E E5 87 06 00 4F 21 C2 64 09 5E 23    .`.#~....O!.d.^#
00E0A0:  56 DD 73 1A DD 72 1B DD 36 09 00 E1 C3 EB 61 23    V.s..r..6.....a#
00E0B0:  7E 32 BB 60 C3 EB 61 23 7E DD 77 0A C3 EB 61 DD    ~2.`..a#~.w...a.
00E0C0:  36 09 10 DD 36 1B 00 7E A0 0F F0 A3 32 ED 60 23    6...6..~...£2.`#
00E0D0:  7E 32 DE 60 C3 EB 61 06 F4 ED 79 06 F6 ED 78 F6    ~2.`..a...y...x.
00E0E0:  C0 ED 79 E6 3F ED 79 06 F4 ED 49 06 F6 4F F6 80    ..y.?.y...I..O..
00E0F0:  ED 79 ED 49 C9 06 38 00 00 02 67 38 67 6E 67 EE    .y.I..8...g8gng.
00E100:  03 80 01 00 08 50 FD 0D 07 81 51 FD 05 18 81 52    .....P....Q....R
00E110:  01 04 08 55 03 04 00 00 04 51 06 04 08 00 08 08    ...U.....Q......
00E120:  00 09 51 00 01 FD 09 40 81 03 10 00 02 01 51 00    ..Q....@......Q.
00E130:  01 FD 0C 52 81 51 04 01 02 00 02 04 52 01 04 08    ...R.Q......R...
00E140:  55 03 02 00 00 04 51 FD 07 7E 81 51 FD 0A 89 81    U.....Q..~.Q....
00E150:  03 30 F0 84 01 51 FD 0D 9B 81 51 04 10 02 00 02    .0...Q....Q.....
00E160:  04 52 01 04 80 55 1C 20 00 00 24 A0 B0 F0 F0 C0    .R...U. ..$.....
00E170:  58 50 80 D0 50 09 A0 B0 F0 A0 A1 12 50 40 10 50    XP..P.......P@.P
00E180:  42 24 A0 A0 50 22 01 A0 A0 F0 F0 F0 00 00 58 50    B$..P"........XP
00E190:  00 12 50 40 00 A0 A1 20 A0 F0 E0 A0 A1 12 50 60    ..P@... ......P`
00E1A0:  70 F0 D0 50 70 F0 84 28 B0 A1 F0 07 D0 50 42 00    p..Pp..(.....PB.
00E1B0:  00 14 50 40 50 13 28 A0 80 A0 A0 09 50 70 10 D0    ..P@P.(.....Pp..
00E1C0:  41 02 A0 C0 10 A0 82 14 50 60 50 02 01 50 50 52    A.......P`P..PPR
00E1D0:  1A 28 B0 00 02 A0 C0 00 D0 41 30 50 40 30 50 50    .(.......A0P@0PP
00E1E0:  02 A0 A0 00 00 24 A0 84 00 00 D0 50 52 00 60 FD    .....$.....PR.`.
00E1F0:  06 8C 82 00 80 50 FD 07 13 82 01 A0 00 FD 0B 1C    .....P..........
00E200:  82 50 02 01 A0 A0 52 FD 0B 32 82 0F C0 20 A0 A1    .P....R..2... ..
00E210:  12 50 60 00 00 14 50 04 00 00 28 B0 52 07 50 50    .P`...P...(.R.PP
00E220:  42 00 00 34 F0 80 50 13 78 F0 F3 F0 F0 09 F0 E0    B..4..P.x.......
00E230:  00 F0 E1 12 F0 C0 10 F0 C2 34 F0 E0 50 02 01 F0    .........4..P...
00E240:  F0 52 20 78 F0 00 12 F0 C0 00 F0 E1 30 F0 F3 FC    .R x........0...
00E250:  F0 F0 12 F0 E0 00 00 34 F0 84 00 00 F0 F0 FF FF    .......4........
00E260:  88 37 FF F8 FD 06 20 83 00 80 50 A1 F0 00 81 FD    .7.... ...P.....
00E270:  0E F7 82 50 00 01 A0 F0 50 FD 0A 10 83 A1 F0 00    ...P....P.......
00E280:  30 FD 09 20 83 A0 F0 03 88 74 F0 F0 FD 06 6A 83    0.. .....t....j.
00E290:  04 08 13 FF 8C 78 A0 F0 0E 09 F0 C2 00 78 E1 12    .....x.......x..
00E2A0:  F0 84 01 F0 C2 34 F0 C2 51 10 78 F0 F0 F0 C0 00    .....4..Q.x.....
00E2B0:  00 78 E1 00 12 F0 84 00 78 E1 30 A1 F0 FD 0A 1F    .x......x.0.....
00E2C0:  83 A0 F0 03 08 34 F0 F0 FD 07 31 83 02 12 F0 84    .....4....1.....
00E2D0:  A1 F0 FD 0F 40 83 51 04 78 F0 F0 F0 E0 FD 0C 58    ....@.Q.x......X
00E2E0:  83 A0 F0 0A E0 30 F0 E0 00 00 70 F0 C0 00 00 A0    .....0....p.....
00E2F0:  F0 01 08 34 FD 06 9E 83 05 70 F0 08 12 F0 C0 A1    ...4.....p......
00E300:  0E 18 0E 4D 0D 8E 0C DA 0B 2F 0B 8F 0A F7 09 68    ...M...../.....h
00E310:  09 E1 08 61 08 E9 07 77 07 0C 07 A7 06 47 06 ED    ...a...w.....G..
00E320:  05 98 05 47 05 FC 04 B4 04 70 04 31 04 F4 03 BC    ...G.....p.1....
00E330:  03 86 03 53 03 24 03 F6 02 CC 02 A4 02 7E 02 5A    ...S.$.......~.Z
00E340:  02 38 02 18 02 FA 01 DE 01 C3 01 AA 01 92 01 7B    .8.............{
00E350:  01 66 01 52 01 3F 01 2D 01 1C 01 0C 01 FD 00 EF    .f.R.?.-........
00E360:  00 E1 00 D5 00 C9 00 BE 00 B3 00 A9 00 9F 00 96    ................
00E370:  00 8E 00 86 00 7F 00 77 00 71 00 6A 00 64 00 5F    .......w.q.j.d._
00E380:  00 59 00 54 00 50 00 4B 00 47 00 43 00 3F 00 3C    .Y.T.P.K.G.C.?.<
00E390:  00 38 00 35 00 32 00 2F 00 2D 00 2A 00 28 00 26    .8.5.2./.-.*.(.&
00E3A0:  00 24 00 22 00 20 00 1E 00 1C 00 1B 00 19 00 18    .$.". ..........
00E3B0:  00 16 00 15 00 14 00 13 00 12 00 11 00 10 00 0F    ................
00E3C0:  5A 07 D1 67 00 01 08 00 01 3F 50 18 DF 08 67 E2    Z..g.....?P...g.
00E3D0:  64 22 65 42 65 10 10 0C 14 64 00 82 66 54 6B 02    d"eBe....d..fTk.
00E3E0:  03 09 01 01 37 50 18 E7 3E 67 62 65 A2 65 42 65    ....7P..>gbe.eBe
00E3F0:  08 00 0C 14 50 00 A2 66 20 6E 04 05 0A 01 01 1F    ....P..f n......
00E400:  50 01 EF 74 FD 0B 03 64 03 7E 02 82 66 57 09 53    P..t...d.~..fW.S
00E410:  54 2D 4D 6F 64 75 6C 65 2E FD 08 E8 63 FD 08 20    T-Module....c.. 
00E420:  64 15 C2 65 02 66 22 66 00 00 62 65 42 66 62 66    d..e.f"f..beBfbf
00E430:  00 00 DC 5E DC 5E DC 5E FD 07 60 64 00 5E FD 08    ...^.^.^..`d.^..
00E440:  60 64 FD 08 60 64 FD 18 60 64 FD 2A 60 64 09 82    `d..`d..`d.*`d..
00E450:  66 A2 66 C2 66 E2 66 DC 5E FD 06 BA 64 FD 06 CA    f.f.f.f.^...d...
00E460:  64 FD 0A CA 64 06 01 00 01 00 01 00 01 56 FD 07    d...d........V..
00E470:  E2 64 56 FD 07 F2 64 56 FD 07 02 65 56 03 0F 0E    .dV...dV...eV...
00E480:  0D 0C B8 80 F2 0D 04 0F 0E 0D 0C 0B AD 0A 17 09    ................
00E490:  08 07 06 05 04 03 02 01 00 80 00 00 01 80 01 00    ................
00E4A0:  02 80 02 00 03 00 04 7F 05 0F 0F 0E 0E 0D 0C 67    ...............g
00E4B0:  00 06 6C 0B 0F 0D 0B 09 07 05 04 06 08 06 04 02    ..l.............
00E4C0:  61 09 07 0B 0F 13 17 1B 1F 13 08 03 84 0A 03 07    a...............
00E4D0:  0C 00 03 07 0C 00 03 07 0C FD 08 A2 66 FD 0D A2    ............f...
00E4E0:  66 08 04 07 0C 00 04 07 0C 00 04 FD 08 C0 66 FD    f.............f.
00E4F0:  0F C0 66 09 03 08 0C 00 03 08 0C 00 03 08 FD 08    ..f.............
00E500:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
00E510:  0C 00 01 00 02 09 4E E5 0C 00 C1 02 00 00 00 02    ......N.........
00E520:  0C 00 C6 02 00 00 00 02 0C 00 C2 02 00 00 00 02    ................
00E530:  0C 00 C7 02 00 00 00 02 0C 00 C3 02 00 00 00 02    ................
00E540:  0C 00 C8 02 00 00 00 02 0C 00 C4 02 00 00 00 02    ................
00E550:  0C 00 C9 02 00 00 00 02 0C 00 C5 02 00 00 00 02    ................
00E560:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00E570:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00E580:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00E590:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00E5A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00E5B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00E5C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00E5D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00E5E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00E5F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00E600:  F0 0E 18 F0 C2 00 78 F0 30 F0 84 01 F0 E0 70 F0    ......x.0.....p.
00E610:  C2 51 FD 07 C2 83 00 F0 FD 07 A5 83 01 F0 30 A0    .Q............0.
00E620:  F0 00 84 FD 0A 69 83 A0 F0 FD 05 0B 84 09 08 00    .....i..........
00E630:  00 25 A5 08 21 A5 C0 D2 A0 5A 0E 81 A5 86 00 2D    .%..!....Z.....-
00E640:  A5 12 5A 0C 01 5A 4A 25 A5 86 51 10 03 A5 A5 A5    ..Z..ZJ%..Q.....
00E650:  B4 00 00 5A 4B 00 12 5A 48 00 2D A5 21 A0 A5 0A    ...ZK..ZH.-.!...
00E660:  A4 30 5A 68 00 00 61 A5 C0 00 00 A0 A5 0D 08 16    .0Zh..a.........
00E670:  5A 5A 5A 48 00 00 52 5A 08 12 5A 48 A1 A5 0E 90    ZZZH..RZ..ZH....
00E680:  5A 4A 00 5A 5A 21 A5 84 01 A5 A4 52 5A 4A 52 34    ZJ.ZZ!.....RZJR4
00E690:  F0 F0 5A 5A 00 00 A5 A5 00 03 A5 C0 00 5A 5A 30    ..ZZ.........ZZ0
00E6A0:  5A 78 F0 5A 4A 21 A5 A4 00 00 52 5A 48 00 00 D2    Zx.ZJ!....RZH...
00E6B0:  5A F0 F0 80 34 F0 E1 A5 84 00 00 25 A5 08 03 A5    Z...4......%....
00E6C0:  C0 D2 5A F0 D2 FD 10 67 84 54 FD 0F 7E 84 03 C0    ..Z....g.T..~...
00E6D0:  10 A5 B4 FD 0B 91 84 00 B4 52 FD 05 25 85 19 43    .........R..%..C
00E6E0:  0F 4C 47 0F 48 87 0F 80 87 0F 90 0F 1F 11 0F 1E    .LG.H...........
00E6F0:  21 0F 2E 23 0F 2C 43 0F 1F 53 1F 11 0F 1E 00 00    !..#.,C..S......
00E700:  87 0F 88 03 0F 48 11 0F 1E 21 0F 48 00 87 1E 21    .....H...!.H...!
00E710:  0F 2C 00 00 43 0F 48 00 00 87 1E 52 00 10 FD 06    .,..C.H....R....
00E720:  70 85 01 3F 8F FD 09 3F 85 13 0F EF 0F 1E 21 0F    p..?...?......!.
00E730:  1F CF 0F 2C 43 0F 0F FF FF FE 10 FF FF EF FD 06    ...,C...........
00E740:  5C 85 04 7F CF 0F 1F EF FD 14 67 85 02 FF FF EC    \.........g.....
00E750:  FD 08 7E 85 A0 0F FD 07 8A 85 A0 0F 01 1E 21 A0    ..~...........!.
00E760:  0F 01 2C 43 A0 0F 01 1E 10 A0 0F 03 1E 00 00 87    ..,C............
00E770:  A3 0F FD 0F B2 85 FD 06 F2 85 00 2C FD 07 C8 85    £..........,....
00E780:  00 63 A0 AF 06 80 D7 5F 80 D7 5F 90 A0 AF 01 BE    .c....._.._.....
00E790:  31 A0 5F 01 6C 63 A0 AF 01 BE 10 A0 AF 03 AC 00    1._.lc..........
00E7A0:  00 D7 A1 5F 10 2F AF BE 21 AF C8 00 A7 BE 31 5F    ..._./..!.....1_
00E7B0:  6C 00 00 43 0F 48 FD 06 3C 86 08 6C 00 00 10 5F    l..C.H..<..l..._
00E7C0:  6C 00 00 31 A0 5F 0C 80 A7 AF 80 A7 AF 80 D7 5F    l..1._........._
00E7D0:  5F 5F 6C 10 A0 AF 01 C8 31 A0 5F 01 5E 10 A0 5F    __l.....1._.^.._
00E7E0:  03 6C 00 00 63 A1 AF 13 DF 5F 6C 31 5F 48 00 D7    .l..c...._l1_H..
00E7F0:  5E 21 AF AC 00 00 63 AF C8 00 00 A7 FD 06 38 86    ^!....c.......8.
00E800:  91 23 22 98 93 C9 FD 06 82 90 15 21 41 93 22 98    .#"........!A.".
00E810:  93 C9 41 93 21 00 C0 11 01 C0 01 FF 3F 75 ED B0    ..A.!.......?u..
00E820:  C9 F2 06 F0 26 C3 62 95 C3 17 94 C3 98 95 C3 B6    ....&.b.........
00E830:  95 C3 DF 95 A5 5F 1E 0E 12 C6 28 59 3A 19 90 FE    ....._....(Y:...
00E840:  FF C8 4F 3A 11 94 FE 4A CA A0 94 79 2A 0F 94 7E    ..O:...J...y*..~
00E850:  FE 0D CA A9 94 FE 09 CA E2 94 23 22 0F 94 21 F0    ..........#"..!.
00E860:  8B D6 20 A7 28 09 E5 26 00 6F 29 29 29 C1 09 E5    .. .(..&.o)))...
00E870:  2A 13 94 3A 11 94 06 00 4F 09 3A 18 90 A7 20 17    *..:....O.:... .
00E880:  3A 11 94 3C 32 11 94 D1 3E 08 01 00 08 08 1A 77    :..<2...>......w
00E890:  08 13 09 3D 20 F7 C9 3A 11 94 C6 02 FD 06 5F 94    ...= ..:......_.
00E8A0:  0F 0E FF 08 1A E6 F0 47 7E E6 0F 80 77 23 1A E6    .......G~...w#..
00E8B0:  0F A0 17 FD 06 83 94 F0 0F 13 06 07 09 08 3D 20    ..............= 
00E8C0:  E0 C9 AF 32 11 94 2A 0F 94 18 04 23 22 0F 94 AF    ...2..*....#"...
00E8D0:  32 11 94 7E FE 0A 28 16 3A 12 94 3C FE 12 28 14    2..~..(.:..<..(.
00E8E0:  32 12 94 2A 13 94 01 4A 00 09 22 13 94 C9 2A 15    2..*...J.."...*.
00E8F0:  94 22 0F 94 AF 32 12 94 3E FF 32 19 90 21 06 C2    ."...2..>.2..!..
00E900:  22 13 94 C9 3A 18 90 A7 20 0A 23 7E 32 11 94 23    "...:... .#~2..#
00E910:  22 0F 94 C9 23 7E 87 18 F3 FD 06 17 94 03 AF 32    "...#~.........2
00E920:  61 95 FD 06 27 94 09 C8 FE FF C8 FE 09 C8 21 58    a...'.........!X
00E930:  95 FD 10 4A 94 00 10 FD 10 62 94 FD 13 7A 94 A0    ...J.....b...z..
00E940:  87 FD 0F 91 94 A4 FF 3A 01 00 21 22 90 3A 60 95    .......:..!".:`.
00E950:  3C BE 28 06 32 60 95 C3 F7 94 AF 32 60 95 3A 61    <.(.2`.....2`.:a
00E960:  95 FE FF 28 18 CD 17 94 3A 12 94 FE 11 20 0E 3A    ...(....:.... .:
00E970:  11 94 FE 4A 20 07 2A 0F 94 23 CD AD 94 C3 F7 94    ...J .*..#......
00E980:  2A 15 94 FD 07 AA 94 0C 32 12 94 32 19 90 32 60    *.......2..2..2`
00E990:  95 3D 32 61 95 FD 0A DB 94 42 F5 3E 01 32 18 90    .=2a.....B.>.2..
00E9A0:  CD 98 95 21 91 C7 22 13 94 21 E5 95 22 0F 94 2A    ...!.."..!.."..*
00E9B0:  0F 94 7E A7 28 05 CD 17 94 18 F4 F1 32 18 90 C9    ..~.(.......2...
00E9C0:  CD 17 94 C3 17 94 50 72 65 73 73 20 73 70 61 63    ......Press spac
00E9D0:  65 20 74 6F 20 63 6F 6E 74 69 6E 75 65 51 16 C3    e to continueQ..
00E9E0:  07 96 C3 40 96 C9 21 50 97 11 06 C2 3E 90 73 23    ...@..!P....>.s#
00E9F0:  72 23 EB 01 00 08 FD 0A 37 92 3F ED 21 09 97 01    r#......7.?.!...
00EA00:  16 10 AF AC 00 00 31 FF FF FF FE 00 F7 FF 80 F7    ......1.........
00EA10:  FF 80 F7 FF FF FF EC 10 A0 FF 01 C8 31 A0 FF 01    ............1...
00EA20:  FE 10 A0 FF 03 C8 00 00 73 A3 FF 12 EC 31 FF C8    ........s£...1..
00EA30:  00 F7 FE 31 FF EC 00 00 73 FF C8 00 00 F7 FF FD    ...1....s.......
00EA40:  06 C5 85 08 FF EC 00 00 10 FF FF FF EC FD 07 B2    ................
00EA50:  86 0B 73 FF FF FF C8 00 F7 FF FF FF 80 10 A0 FF    ..s.............
00EA60:  01 FE 10 A0 FF 03 80 00 00 31 A3 FF 00 C8 FD 1A    .........1£.....
00EA70:  DB 86 50 03 F3 FF FF C0 FD 07 FC 86 0C 30 FF FF    ..P..........0..
00EA80:  FE 80 00 71 FF FF FC 00 00 F3 FD 08 10 87 00 FC    ...q............
00EA90:  50 01 10 F7 A1 FF 01 FE 80 FD 1A 25 87 50 17 30    P..........%.P.0
00EAA0:  F0 F0 00 00 F0 F0 80 F0 F0 80 00 F0 F0 C0 00 00    ................
00EAB0:  10 F0 F0 80 00 00 30 A0 F0 04 10 F0 F0 F0 C0 51    ......0........Q
00EAC0:  00 70 A1 F0 07 E0 00 30 F0 C0 00 F0 F0 FD 0A FD    .p.....0........
00EAD0:  83 A0 F0 05 E0 00 00 10 F0 E0 F3 20 02 15 70 70    ........... ..pp
00EAE0:  50 30 B0 80 50 D0 D0 D0 40 E0 E0 70 70 70 00 80    P0..P...@..ppp..
00EAF0:  80 B0 B0 A0 81 16 20 50 70 20 10 00 50 10 50 50    ...... Pp ..P.PP
00EB00:  40 A0 80 40 50 50 10 70 40 A0 A0 A0 80 80 16 20    @..@PP.p@...... 
00EB10:  50 50 30 10 10 50 90 10 10 C0 A0 C0 50 70 70 10    PP0..P......Ppp.
00EB20:  40 40 B0 B0 B0 80 80 12 20 70 50 30 90 10 D0 D0    @@...... pP0....
00EB30:  10 00 40 E0 80 70 40 50 10 70 40 A0 80 91 01 80    ..@..p@P.p@.....
00EB40:  80 F2 77 A1 38 05 00 38 00 6C 6C 6C 52 22 6C 6C    ..w.8..8.lllR"ll
00EB50:  FE 6C FE 6C 6C 00 18 7E D8 7C 1A FC 18 00 00 C6    .l.ll..~.|......
00EB60:  CC 18 30 66 C6 00 38 6C 38 76 DC CC 76 00 1C 1C    ..0f..8l8v..v...
00EB70:  38 52 15 0C 18 30 30 30 18 0C 00 30 18 0C 0C 0C    8R...000...0....
00EB80:  18 30 00 00 66 3C FF 3C 66 50 04 18 18 7E 18 18    .0..f<.<fP...~..
00EB90:  54 02 18 18 30 50 00 7E 56 14 18 18 00 06 0E 1C    T...0P.~V.......
00EBA0:  38 70 E0 C0 00 7C E6 EE F6 E6 E6 7C 00 38 78 A0    8p...|.....|.8x.
00EBB0:  38 40 FE 00 7C EE 06 7C E0 E6 FE 00 7C CE 0E 1C    8@..|..|....|...
00EBC0:  0E CE 7C 00 1E 3E 6E CE FE 0E 0E 00 FE E2 E0 FC    ..|..>n.........
00EBD0:  06 C6 7C 00 7C E6 E0 FC E6 E6 7C 00 FE C6 06 0C    ..|.|.....|.....
00EBE0:  18 18 18 00 7C E6 E6 7C E6 E6 7C 00 7C E6 E6 7E    ....|..|..|.|..~
00EBF0:  06 E6 7C 50 04 18 18 00 18 18 50 FD 05 C2 8C 07    ..|P......P.....
00EC00:  14 00 E5 C5 11 1D 97 ED B0 C1 E1 11 31 97 ED B0    ............1...
00EC10:  06 08 C5 CD A0 96 C1 10 F9 C9 3E 0A DD 21 1D 97    ..........>..!..
00EC20:  16 00 08 01 50 97 DD 6E 00 62 29 09 4E 23 46 DD    ....P..n.b).N#F.
00EC30:  6E 01 5D 62 09 4E 79 E6 F0 77 79 FD 0A 14 96 39    n.]b.Ny..wy....9
00EC40:  E6 0F FE 0F 28 08 A7 28 05 17 FE 10 20 0F 1D 7B    ....(..(.... ..{
00EC50:  A7 20 06 3E 49 01 49 00 09 DD 77 01 2B DD 7E 00    . .>I.I...w.+.~.
00EC60:  3C FE 90 20 05 7E E6 F0 77 AF DD 77 00 DD 23 DD    <.. .~..w..w..#.
00EC70:  23 08 3D 20 A8 3E 0A DD 21 31 FD 16 45 96 00 7E    #.= .>..!1..E..~
00EC80:  FD 17 61 96 00 16 FD 0F 79 96 0C 7E E6 F0 3C 77    ..a.....y..~..<w
00EC90:  18 06 4F 7E E6 F0 81 77 FD 17 88 96 3D A0 C9 05    ..O~...w....=...
00ECA0:  05 79 2D 2D 20 69 40 3B 36 8D 1C 11 33 48 02 32    .y-- i@;6...3H.2
00ECB0:  12 65 1A 8A 20 6E 48 22 3B 5E 12 30 08 82 37 06    .e.. nH";^.0..7.
00ECC0:  05 3D 1D 27 2D 5A 35 02 1E 76 46 2A 39 66 10 38    .=.'-Z5..vF*9f.8
00ECD0:  06 8A 35 0E 03 45 1B 2F 2B 62 33 58 F0 CF 06 C2    ..5..E./+b3X....
00ECE0:  06 CA 06 D2 06 DA 06 E2 06 EA 06 F2 06 FA 50 C2    ..............P.
00ECF0:  50 CA 50 D2 50 DA 50 E2 50 EA 50 F2 50 FA 9A C2    P.P.P.P.P.P.P...
00ED00:  9A CA 9A D2 9A DA 9A E2 9A EA 9A F2 9A FA E4 C2    ................
00ED10:  E4 CA E4 D2 E4 DA E4 E2 E4 EA E4 F2 E4 FA 2E C3    ................
00ED20:  2E CB 2E D3 2E DB 2E E3 2E EB 2E F3 2E FB 78 C3    ..............x.
00ED30:  78 CB 78 D3 78 DB 78 E3 78 EB 78 F3 78 FB C2 C3    x.x.x.x.x.x.x...
00ED40:  C2 CB C2 D3 C2 DB C2 E3 C2 EB C2 F3 C2 FB 0C C4    ................
00ED50:  0C CC 0C D4 0C DC 0C E4 0C EC 0C F4 0C FC 56 C4    ..............V.
00ED60:  56 CC 56 D4 56 DC 56 E4 56 EC 56 F4 56 FC A0 C4    V.V.V.V.V.V.V...
00ED70:  A0 CC A0 D4 A0 DC A0 E4 A0 EC A0 F4 A0 FC EA C4    ................
00ED80:  EA CC EA D4 EA DC EA E4 EA EC EA F4 EA FC 34 C5    ..............4.
00ED90:  34 CD 34 D5 34 DD 34 E5 34 ED 34 F5 34 FD 7E C5    4.4.4.4.4.4.4.~.
00EDA0:  7E CD 7E D5 7E DD 7E E5 7E ED 7E F5 7E FD C8 C5    ~.~.~.~.~.~.~...
00EDB0:  C8 CD C8 D5 C8 DD C8 E5 C8 ED C8 F5 C8 FD 12 C6    ................
00EDC0:  12 CE 12 D6 12 DE 12 E6 12 EE 12 F6 12 FE 5C C6    ..............\.
00EDD0:  5C CE 5C D6 5C DE 5C E6 5C EE 5C F6 5C FE A6 C6    \.\.\.\.\.\.\...
00EDE0:  A6 CE A6 D6 A6 DE A6 E6 A6 EE A6 F6 A6 FE F0 C6    ................
00EDF0:  F0 CE F0 D6 F0 DE F0 E6 F0 EE F0 F6 F0 FE F3 90    ................
00EE00:  30 0C 1C 38 70 38 1C 0C 50 44 7E 00 00 7E 00 00    0..8p8..PD~..~..
00EE10:  60 70 38 1C 38 70 60 00 7C E6 E6 0C 38 00 38 00    `p8.8p`.|...8.8.
00EE20:  60 10 7C 0E 7E CE 76 00 38 7C E6 E6 FE E6 E6 00    `.|.~.v.8|......
00EE30:  FC E6 E6 FC E6 E6 FC 00 7C E6 E0 E0 E0 E6 7C 00    ........|.....|.
00EE40:  F8 EC E6 E6 E6 EC F8 00 FE E2 E8 F8 E8 E2 FE FD    ................
00EE50:  06 17 8D 13 E0 F0 00 7E E6 E0 E0 EE E6 7E 00 E6    .......~.....~..
00EE60:  E6 E6 FE FE E6 E6 00 FE A1 38 2A FE 00 1E 0C 0C    .........8*.....
00EE70:  0C CC CC 78 00 E6 66 6C 78 6C 66 E6 00 F0 E0 E0    ...x..flxlf.....
00EE80:  E0 E2 E6 FE 00 C6 EE FE FE D6 C6 C6 00 C6 E6 F6    ................
00EE90:  FE EE E6 E6 00 7C A1 E6 23 7C 00 FC E6 E6 FC E0    .....|..#|......
00EEA0:  E0 E0 00 7C E6 E6 E6 EA EC 76 00 FC E6 E6 FC EC    ...|.....v......
00EEB0:  E6 E6 00 7C E6 E0 7C 0E CE 7C 00 FE BA A0 38 01    ...|..|..|....8.
00EEC0:  7C 00 A2 E6 01 7C 00 A0 E6 24 66 3C 18 00 C6 C6    |....|...$f<....
00EED0:  C6 D6 FE EE C6 00 C6 6C 38 38 6C C6 C6 00 E6 E6    .......l88l.....
00EEE0:  E6 7C 18 18 7C 00 FE C6 CC 18 30 66 FE 00 7C A1    .|..|.....0f..|.
00EEF0:  70 00 7C 50 06 7C E6 E0 7E 08 18 3E A1 0E 04 3E    p.|P.|..~..>...>
00EF00:  00 18 3C 24 58 04 FF FF 70 38 1C 54 FD 06 F2 8C    ..<$X...p8.T....
00EF10:  06 E0 E0 FC E6 E6 E6 DC 50 0C 7C E6 E0 E6 7C 00    ........P.|...|.
00EF20:  0E 0E 7E CE CE CE 76 50 0C 7C E6 FE E0 7C 00 3C    ..~...vP.|...|.<
00EF30:  76 70 F8 70 70 F8 50 26 7E E6 E6 7E 06 7C E0 E0    vp.pp.P&~..~.|..
00EF40:  EC F6 E6 E6 E6 00 18 00 78 38 38 38 7C 00 06 00    ........x888|...
00EF50:  0E 06 06 E6 E6 7C E0 E0 E6 EC F8 EC E6 00 78 A1    .....|........x.
00EF60:  38 00 7C 50 04 6C FE D6 D6 C6 50 00 DC A0 E6 50    8.|P.l....P....P
00EF70:  04 7C E6 E6 E6 7C 50 14 DC E6 E6 FC E0 F0 00 00    .|...|P.........
00EF80:  76 CE CE 7E 0E 1E 00 00 DC F6 E0 E0 F0 50 0C 7C    v..~.........P.|
00EF90:  E0 7C 0E 7C 00 70 70 FC 70 70 76 3C 50 A0 E6 00    .|.|.pp.ppv<P...
00EFA0:  7E 50 04 E6 E6 E6 7C 38 50 04 C6 D6 D6 FE 6C 50    ~P....|8P.....lP
00EFB0:  04 C6 6C 38 6C C6 50 0F E6 E6 E6 7E 06 7C 00 00    ..l8l.P....~.|..
00EFC0:  FE DC 38 72 FE 00 06 08 FD 06 1A 8E 01 30 08 A0    ..8r.........0..
00EFD0:  E6 03 7E 00 60 10 FD 06 CA 8E 01 76 DC 53 06 3C    ..~.`......v.S.<
00EFE0:  66 60 F8 60 66 FE 56 1B 6C FE FE FE 7C 38 10 00    f`.`f.V.l...|8..
00EFF0:  18 1C 1E 1B 18 78 F8 70 38 44 BA A2 BA 44 38 00    .....x.p8D...D8.
00F000:  07 FF F3 CD 0F 00 3B 3B E1 01 7A DE 09 5E 23 56    ......;;..z..^#V
00F010:  01 11 00 09 7E 23 4E FE FF CA 00 90 FE 50 30 08    ....~#N......P0.
00F020:  3C 4F 06 00 ED B0 18 EC FE A0 30 08 D6 4D 4F 06    <O........0..MO.
00F030:  00 AF 18 70 FE F0 30 09 D6 9C 4F 06 00 7E 23 18    ...p..0...O..~#.
00F040:  63 FE FD 20 05 06 00 23 18 07 FE FE 20 0F 23 46    c.. ...#.... .#F
00F050:  23 D5 5E 23 56 23 E3 EB ED B0 E1 18 B7 D6 F0 20    #.^#V#......... 
00F060:  0C 7E 23 C6 51 4F 06 00 30 09 04 18 06 3D 20 07    .~#.QO..0....= .
00F070:  23 46 23 ED B0 18 9D 3D 20 08 AF F5 7E 23 C6 53    #F#....= ...~#.S
00F080:  18 13 3D 20 06 23 46 23 AF 18 19 3D 20 10 7E 23    ..= .#F#...= .~#
00F090:  F5 7E 23 C6 54 4F 06 00 30 01 04 F1 18 06 7E 23    .~#.TO..0.....~#
00F0A0:  4E 23 46 23 E5 0B 62 6B 13 77 ED B0 E1 18 C6 1A    N#F#..bk.w......
00F0B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00F0C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00F0D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00F0E0:  1A 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00F0F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00F100:  9A CA 9A D2 9A DA 9A E2 9A EA 9A F2 9A FA E4 C2    ................
00F110:  E4 CA E4 D2 E4 DA E4 E2 E4 EA E4 F2 E4 FA 2E C3    ................
00F120:  2E CB 2E D3 2E DB 2E E3 2E EB 2E F3 2E FB 78 C3    ..............x.
00F130:  78 CB 78 D3 78 DB 78 E3 78 EB 78 F3 78 FB C2 C3    x.x.x.x.x.x.x...
00F140:  C2 CB C2 D3 C2 DB C2 E3 C2 EB C2 F3 C2 FB 0C C4    ................
00F150:  0C CC 0C D4 0C DC 0C E4 0C EC 0C F4 0C FC 56 C4    ..............V.
00F160:  56 CC 56 D4 56 DC 56 E4 56 EC 56 F4 56 FC A0 C4    V.V.V.V.V.V.V...
00F170:  A0 CC A0 D4 A0 DC A0 E4 A0 EC A0 F4 A0 FC EA C4    ................
00F180:  EA CC EA D4 EA DC EA E4 EA EC EA F4 EA FC 34 C5    ..............4.
00F190:  34 CD 34 D5 34 DD 34 E5 34 ED 34 F5 34 FD 7E C5    4.4.4.4.4.4.4.~.
00F1A0:  7E CD 7E D5 7E DD 7E E5 7E ED 7E F5 7E FD C8 C5    ~.~.~.~.~.~.~...
00F1B0:  C8 CD C8 D5 C8 DD C8 E5 C8 ED C8 F5 C8 FD 12 C6    ................
00F1C0:  12 CE 12 D6 12 DE 12 E6 12 EE 12 F6 12 FE 5C C6    ..............\.
00F1D0:  5C CE 5C D6 5C DE 5C E6 5C EE 5C F6 5C FE A6 C6    \.\.\.\.\.\.\...
00F1E0:  A6 CE A6 D6 A6 DE A6 E6 A6 EE A6 F6 A6 FE F0 C6    ................
00F1F0:  F0 CE F0 D6 F0 DE F0 E6 F0 EE F0 F6 F0 FE F3 90    ................
00F200:  18 3C 7E FF A4 18 14 FF 7E 3C 18 10 30 70 FF FF    .<~.....~<..0p..
00F210:  70 30 10 08 0C 0E FF FF 0E 0C 08 00 A2 7E 0A 00    p0...........~..
00F220:  10 10 FE 7C 38 6C 82 00 00 7E A0 42 00 7E 66 F0    ...|8l...~.B.~f.
00F230:  40 88 10 85 40 51 54 2C 1D 73 18 32 53 03 0F 78    @...@QT,.s.2S..x
00F240:  0D 26 5F 79 87 0E 68 14 41 6A 69 06 2D 1A 4B 07    .&_y..h.Aji.-.K.
00F250:  55 01 19 74 6B 47 3D 31 50 2E 7F 33 3E 11 60 65    U..tkG=1P..3>.`e
00F260:  86 8B 0A 63 35 43 7D 21 6C 8C 42 57 4D 36 67 17    ...c5C}!l.BWM6g.
00F270:  5D 5B 80 83 4F 13 49 7A 16 3A 30 3F 6F 37 2F 04    ][..O.Iz.:0?o7/.
00F280:  29 70 3B 0C 7E 75 34 00 39 8A 12 4E 61 6E 38 4C    )p;.~u4.9..Nan8L
00F290:  3C 5C 81 7B 7C 66 48 28 15 05 1F 5E 45 2A 1B 8D    <\.{|fH(...^E*..
00F2A0:  0B 62 89 6D 2B 52 56 4A 76 46 09 44 08 20 5A 25    .b.m+RVJvF.D. Z%
00F2B0:  71 77 23 64 58 8E 84 24 22 02 59 1C 82 72 27 1E    qw#dX..$".Y..r'.
00F2C0:  8F FF 5C F0 A5 C3 2B 90 5F 54 01 54 55 57 53 58    ..\...+._T.TUWSX
00F2D0:  5D 4C 48 4D 56 46 57 5E 40 5F 4E 54 4B 01 00 4B    ]LHMVFW^@_NTK..K
00F2E0:  49 4B 49 4B 4A 4A 4A 04 01 01 01 60 8F 00 C3 41    IKIKJJJ....`...A
00F2F0:  CD 14 BC F3 2A 38 00 22 29 90 21 FB C9 22 38 00    ....*8.").!.."8.
00F300:  08 F5 08 01 01 BC ED 49 01 25 BD ED 49 01 02 BC    .......I.%..I...
00F310:  ED 49 01 2C BD ED 49 01 06 BC ED 49 01 1B BD ED    .I.,..I....I....
00F320:  49 01 07 BC ED 49 01 20 BD ED 49 01 05 BC ED 49    I....I. ..I....I
00F330:  01 01 BD ED 49 3E 10 21 06 90 01 00 7F ED 49 5E    ....I>.!......I^
00F340:  ED 59 0C 23 3D 20 F6 3A 06 90 32 75 91 0E 8D 3A    .Y.#= .:..2u...:
00F350:  18 90 A7 20 01 0C 79 32 56 91 0E 8C 3A 05 90 A7    ... ..y2V...:...
00F360:  28 01 0C 79 32 DD 90 CD 26 92 CD 00 60 CD 00 96    (..y2...&...`...
00F370:  3A 24 90 A7 C4 09 94 CD 06 94 3A 23 90 A7 20 0F    :$........:#.. .
00F380:  21 03 94 3A 25 90 FE 02 28 08 21 0C 94 18 03 21    !..:%...(.!....!
00F390:  00 94 22 09 91 3E FF 32 7A 92 06 F5 ED 78 1F 30    .."..>.2z....x.0
00F3A0:  FB 01 8D 7F ED 49 0E 10 ED 49 3A 06 90 ED 79 0E    .....I...I:...y.
00F3B0:  00 ED 49 ED 79 0C ED 49 3A 07 90 FD 06 EE 90 00    ..I.y..I:.......
00F3C0:  08 FD 07 F5 90 22 09 90 ED 79 CD 00 94 3A 7A 92    ....."...y...:z.
00F3D0:  FE 7F 20 0E 3A 19 90 A7 CA 2E 91 3E FF 32 28 90    .. .:......>.2(.
00F3E0:  18 03 3A 28 90 A7 C4 BA 91 FD 06 20 91 1E 91 3A    ..:(....... ...:
00F3F0:  04 90 32 AC 91 CD 66 93 FB 76 F3 CD 03 96 FB 76    ..2...f..v.....v
00F400:  00 4C 41 52 47 45 52 20 20 46 4E 54 00 00 00 00    .LARGER  FNT....
00F410:  00 00 02 00 00 00 7D 00 00 03 00 7D 00 00 00 00    ......}....}....
00F420:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00F430:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00F440:  00 03 00 E7 03 00 00 4C 41 52 47 45 52 20 20 24    .......LARGER  $
00F450:  24 24 FF 00 FF 00 00 02 00 00 00 40 00 00 40 00    $$.........@..@.
00F460:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00F470:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00F480:  00 00 00 00 00 00 00 00 38 38 38 38 38 00 38 00    ........88888.8.
00F490:  6C 6C 6C 00 00 00 00 00 6C 6C FE 6C FE 6C 6C 00    lll.....ll.l.ll.
00F4A0:  18 7E D8 7C 1A FC 18 00 00 C6 CC 18 30 66 C6 00    .~.|........0f..
00F4B0:  38 6C 38 76 DC CC 76 00 1C 1C 38 00 00 00 00 00    8l8v..v...8.....
00F4C0:  0C 18 30 30 30 18 0C 00 30 18 0C 0C 0C 18 30 00    ..000...0.....0.
00F4D0:  00 66 3C FF 3C 66 00 00 00 18 18 7E 18 18 00 00    .f<.<f.....~....
00F4E0:  00 00 00 00 00 18 18 30 00 00 00 7E 00 00 00 00    .......0...~....
00F4F0:  00 00 00 00 00 18 18 00 06 0E 1C 38 70 E0 C0 00    ...........8p...
00F500:  7C E6 EE F6 E6 E6 7C 00 38 78 38 38 38 38 FE 00    |.....|.8x8888..
00F510:  7C EE 06 7C E0 E6 FE 00 7C CE 0E 1C 0E CE 7C 00    |..|....|.....|.
00F520:  1E 3E 6E CE FE 0E 0E 00 FE E2 E0 FC 06 C6 7C 00    .>n...........|.
00F530:  7C E6 E0 FC E6 E6 7C 00 FE C6 06 0C 18 18 18 00    |.....|.........
00F540:  7C E6 E6 7C E6 E6 7C 00 7C E6 E6 7E 06 E6 7C 00    |..|..|.|..~..|.
00F550:  00 00 18 18 00 18 18 00 00 00 18 18 00 18 18 30    ...............0
00F560:  0C 1C 38 70 38 1C 0C 00 00 00 7E 00 00 7E 00 00    ..8p8.....~..~..
00F570:  60 70 38 1C 38 70 60 00 7C E6 E6 0C 38 00 38 00    `p8.8p`.|...8.8.
00F580:  60 10 7C 0E 7E CE 76 00 38 7C E6 E6 FE E6 E6 00    `.|.~.v.8|......
00F590:  FC E6 E6 FC E6 E6 FC 00 7C E6 E0 E0 E0 E6 7C 00    ........|.....|.
00F5A0:  F8 EC E6 E6 E6 EC F8 00 FE E2 E8 F8 E8 E2 FE 00    ................
00F5B0:  FE E2 E8 F8 E8 E0 F0 00 7E E6 E0 E0 EE E6 7E 00    ........~.....~.
00F5C0:  E6 E6 E6 FE FE E6 E6 00 FE 38 38 38 38 38 FE 00    .........88888..
00F5D0:  1E 0C 0C 0C CC CC 78 00 E6 66 6C 78 6C 66 E6 00    ......x..flxlf..
00F5E0:  F0 E0 E0 E0 E2 E6 FE 00 C6 EE FE FE D6 C6 C6 00    ................
00F5F0:  C6 E6 F6 FE EE E6 E6 00 7C E6 E6 E6 E6 E6 7C 00    ........|.....|.
00F600:  F3 FB 76 F3 CD 8E 91 3A 17 90 01 02 7F FD 07 EC    ..v....:........
00F610:  90 47 ED 79 01 8D 7F ED 49 CD C5 92 FB 76 F3 00    .G.y....I....v..
00F620:  00 06 2C 10 FE 3A 06 90 32 AC 91 CD 8E 91 01 8D    ..,..:..2.......
00F630:  7F ED 49 3E 54 01 01 7F ED 49 ED 79 CD 43 92 3A    ..I>T....I.y.C.:
00F640:  7B 92 FE FB CA 7C 92 CD 03 60 C3 D5 90 06 04 00    {....|...`......
00F650:  10 FD 01 10 7F 3A 03 90 ED 49 FD 08 E8 90 0B 21    .....:...I.....!
00F660:  F0 FF 23 7C A7 20 FB 3E 54 0E 10 FD 0A 99 91 3C    ..#|. .>T......<
00F670:  C9 2A 26 90 7E FE FF CA 18 92 23 22 26 90 21 BC    .*&.~.....#"&.!.
00F680:  C1 01 4A 00 09 D6 08 30 FB C6 08 01 00 08 A7 28    ..J....0.......(
00F690:  04 09 3D 20 FC 0E 00 3A 18 90 A7 28 02 0E 0F 06    ..= ...:...(....
00F6A0:  08 7E A1 77 23 7E A1 77 23 7E A1 77 23 FD 08 EA    .~.w#~.w#~.w#...
00F6B0:  91 FD 10 EA 91 01 10 DA FD 07 06 92 4E C9 AF 32    ............N..2
00F6C0:  28 90 32 19 90 21 60 8F 22 26 90 C9 3E 30 21 00    (.2..!`."&..>0!.
00F6D0:  7E 11 00 C0 01 4A 00 ED B0 EB 01 B6 07 09 30 04    ~....J........0.
00F6E0:  01 4A C0 09 EB 3D 20 EC C9 21 7A 92 01 0E F4 ED    .J...= ..!z.....
00F6F0:  49 01 C0 F6 ED 49 AF ED 79 01 92 F7 ED 49 0E 45    I....I..y....I.E
00F700:  06 F6 ED 49 06 F4 ED 78 77 23 0E 48 FD 09 5A 92    ...I...xw#.H..Z.
00F710:  0D 01 82 F7 ED 49 01 00 F6 ED 49 C9 FF FB F3 FD    .....I....I.....
00F720:  06 3E 90 00 28 FD 09 45 90 00 2E FD 09 4F 90 00    .>..(..E.....O..
00F730:  19 FD 09 59 90 00 1E FD 09 63 90 31 00 BD ED 49    ...Y.....c.1...I
00F740:  2A 29 90 22 38 00 08 F1 08 CD 9A 93 CD 06 96 FB    *)."8...........
00F750:  CD A7 BC C3 00 BB E1 06 2F 10 FE 3E 12 1E 0D 01    ......../..>....
00F760:  01 7F DD 21 1A 90 ED 49 08 DD 7E 00 ED 79 50 08    ...!...I..~..yP.
00F770:  7B 3D 20 FD DD 7E 01 ED 79 50 FD 06 E0 92 02 02    {= ..~..yP......
00F780:  ED 79 50 FD 06 EC 92 02 03 ED 79 50 FD 06 F8 92    .yP.......yP....
00F790:  02 04 ED 79 50 FD 06 04 93 02 05 ED 79 50 FD 06    ...yP.......yP..
00F7A0:  10 93 02 06 ED 79 50 FD 06 1C 93 21 07 ED 79 7B    .....yP....!..y{
00F7B0:  3D 3D 20 FD 08 3D 20 9D 3E 54 ED 79 C3 5D 91 54    == ..= .>T.y.].T
00F7C0:  54 54 50 50 50 55 55 55 53 53 53 49 49 49 A2 4B    TTPPPUUUSSSIII.K
00F7D0:  34 49 49 49 53 53 53 55 55 55 50 50 50 54 54 54    4IIISSSUUUPPPTTT
00F7E0:  00 3A 24 90 A7 C8 3A 19 90 FE FF 20 19 3A 28 90    .:$...:.... .:(.
00F7F0:  A7 20 13 2A 98 93 7E A7 20 04 21 41 93 7E 32 75    . .*..~. .!A.~2u
00F800:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
00F810:  0D 00 01 00 02 09 4E E5 0D 00 C1 02 00 00 00 02    ......N.........
00F820:  0D 00 C6 02 00 00 00 02 0D 00 C2 02 00 00 00 02    ................
00F830:  0D 00 C7 02 00 00 00 02 0D 00 C3 02 00 00 00 02    ................
00F840:  0D 00 C8 02 00 00 00 02 0D 00 C4 02 00 00 00 02    ................
00F850:  0D 00 C9 02 00 00 00 02 0D 00 C5 02 00 00 00 02    ................
00F860:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00F870:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00F880:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00F890:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00F8A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00F8B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00F8C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00F8D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00F8E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00F8F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00F900:  FC E6 E6 FC E0 E0 E0 00 7C E6 E6 E6 EA EC 76 00    ........|.....v.
00F910:  FC E6 E6 FC EC E6 E6 00 7C E6 E0 7C 0E CE 7C 00    ........|..|..|.
00F920:  FE BA 38 38 38 38 7C 00 E6 E6 E6 E6 E6 E6 7C 00    ..8888|.......|.
00F930:  E6 E6 E6 E6 66 3C 18 00 C6 C6 C6 D6 FE EE C6 00    ....f<..........
00F940:  C6 6C 38 38 6C C6 C6 00 E6 E6 E6 7C 18 18 7C 00    .l88l......|..|.
00F950:  FE C6 CC 18 30 66 FE 00 7C 70 70 70 70 70 7C 00    ....0f..|ppppp|.
00F960:  00 00 7C E6 E0 7E 08 18 3E 0E 0E 0E 0E 0E 3E 00    ..|..~..>.....>.
00F970:  18 3C 24 00 00 00 00 00 00 00 00 00 00 00 FF FF    .<$.............
00F980:  70 38 1C 00 00 00 00 00 00 00 7C 0E 7E CE 76 00    p8........|.~.v.
00F990:  E0 E0 FC E6 E6 E6 DC 00 00 00 7C E6 E0 E6 7C 00    ..........|...|.
00F9A0:  0E 0E 7E CE CE CE 76 00 00 00 7C E6 FE E0 7C 00    ..~...v...|...|.
00F9B0:  3C 76 70 F8 70 70 F8 00 00 00 7E E6 E6 7E 06 7C    <vp.pp....~..~.|
00F9C0:  E0 E0 EC F6 E6 E6 E6 00 18 00 78 38 38 38 7C 00    ..........x888|.
00F9D0:  06 00 0E 06 06 E6 E6 7C E0 E0 E6 EC F8 EC E6 00    .......|........
00F9E0:  78 38 38 38 38 38 7C 00 00 00 6C FE D6 D6 C6 00    x88888|...l.....
00F9F0:  00 00 DC E6 E6 E6 E6 00 00 00 7C E6 E6 E6 7C 00    ..........|...|.
00FA00:  00 00 DC E6 E6 FC E0 F0 00 00 76 CE CE 7E 0E 1E    ..........v..~..
00FA10:  00 00 DC F6 E0 E0 F0 00 00 00 7C E0 7C 0E 7C 00    ..........|.|.|.
00FA20:  70 70 FC 70 70 76 3C 00 00 00 E6 E6 E6 E6 7E 00    pp.ppv<.......~.
00FA30:  00 00 E6 E6 E6 7C 38 00 00 00 C6 D6 D6 FE 6C 00    .....|8.......l.
00FA40:  00 00 C6 6C 38 6C C6 00 00 00 E6 E6 E6 7E 06 7C    ...l8l.......~.|
00FA50:  00 00 FE DC 38 72 FE 00 06 08 7C E6 FE E0 7C 00    ....8r....|...|.
00FA60:  30 08 E6 E6 E6 E6 7E 00 60 10 7C E6 FE E0 7C 00    0.....~.`.|...|.
00FA70:  76 DC 00 00 00 00 00 00 3C 66 60 F8 60 66 FE 00    v.......<f`.`f..
00FA80:  60 10 7C 0E 7E CE 76 00 38 7C E6 E6 FE E6 E6 00    `.|.~.v.8|......
00FA90:  FC E6 E6 FC E6 E6 FC 00 7C E6 E0 E0 E0 E6 7C 00    ........|.....|.
00FAA0:  F8 EC E6 E6 E6 EC F8 00 FE E2 E8 F8 E8 E2 FE 00    ................
00FAB0:  FE E2 E8 F8 E8 E0 F0 00 7E E6 E0 E0 EE E6 7E 00    ........~.....~.
00FAC0:  E6 E6 E6 FE FE E6 E6 00 FE 38 38 38 38 38 FE 00    .........88888..
00FAD0:  1E 0C 0C 0C CC CC 78 00 E6 66 6C 78 6C 66 E6 00    ......x..flxlf..
00FAE0:  F0 E0 E0 E0 E2 E6 FE 00 C6 EE FE FE D6 C6 C6 00    ................
00FAF0:  C6 E6 F6 FE EE E6 E6 00 7C E6 E6 E6 E6 E6 7C 00    ........|.....|.
00FB00:  00 50 43 2D 43 47 41 20 20 47 57 45 00 00 00 00    .PC-CGA  GWE....
00FB10:  00 00 02 00 00 00 90 00 91 00 00 00 00 00 00 00    ................
00FB20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00FB30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00FB40:  91 00 00 62 04 71 73 75 77 79 7B 7D 7F 81 83 85    ...b.qsuwy{}....
00FB50:  87 89 8B 8D 8F FF 1A 00 00 61 64 F2 2C 1C FF 00    .........ad.,...
00FB60:  00 20 00 3C 00 CB 20 22 70 63 2D 63 67 61 2E 67    . .<.. "pc-cga.g
00FB70:  77 65 22 2C 0D 00 00 E2 2C 1C 00 90 2C 1C 91 00    we",....,...,...
00FB80:  00 02 04 06 08 0A 0C 0E 10 12 14 16 18 1A 1C 1E    ................
00FB90:  20 22 24 26 28 2A 2C 2E 30 32 34 36 38 3A 3C 3E     "$&(*,.02468:<>
00FBA0:  40 42 44 46 48 4A 4C 4E 50 52 54 56 58 5A 5C 5E    @BDFHJLNPRTVXZ\^
00FBB0:  60 62 64 66 68 6A 6C 6E 70 72 74 76 78 7A 7C 7E    `bdfhjlnprtvxz|~
00FBC0:  80 82 84 86 88 8A 8C 8E 01 03 05 07 09 0B 0D 0F    ................
00FBD0:  11 13 15 17 19 1B 1D 1F 21 23 25 27 29 2B 2D 2F    ........!#%')+-/
00FBE0:  31 33 35 37 39 3B 3D 3F 41 43 45 47 49 4B 4D 4F    13579;=?ACEGIKMO
00FBF0:  51 53 55 57 59 5B 5D 5F 61 63 65 67 69 6B 6D 6F    QSUWY[]_acegikmo
00FC00:  71 73 75 77 79 7B 7D 7F 81 83 85 87 89 8B 8D 8F    qsuwy{}.........
00FC10:  FF 1A 00 00 61 64 F2 2C 1C FF 00 00 20 00 3C 00    ....ad.,.... .<.
00FC20:  CB 20 22 70 63 2D 63 67 61 2E 67 77 65 22 2C 0D    . "pc-cga.gwe",.
00FC30:  00 00 E2 2C 1C 00 90 2C 1C 91 00 00 00 00 1A AA    ...,...,........
00FC40:  55 55 55 55 AA AA AA AA 55 55 55 55 AA AA AA AA    UUUU....UUUU....
00FC50:  55 55 55 55 AA AA AA AA 55 55 55 55 AA AA AA AA    UUUU....UUUU....
00FC60:  55 55 55 55 AA AA AA AA 55 55 55 55 AA AA AA AA    UUUU....UUUU....
00FC70:  55 55 55 55 AA AA AA AA 55 55 55 55 AA AA AA AA    UUUU....UUUU....
00FC80:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00FC90:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00FCA0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00FCB0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00FCC0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00FCD0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00FCE0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00FCF0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
00FD00:  00 4C 49 4E 45 4F 55 54 20 46 4E 54 00 00 00 00    .LINEOUT FNT....
00FD10:  00 00 02 00 00 00 7D 00 00 03 00 7D 00 00 00 00    ......}....}....
00FD20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00FD30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00FD40:  00 03 00 2A 04 00 00 4C 49 4E 45 4F 55 54 20 24    ...*...LINEOUT $
00FD50:  24 24 FF 00 FF 00 00 02 00 00 00 40 00 00 40 00    $$.........@..@.
00FD60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00FD70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00FD80:  00 00 00 00 00 00 00 00 18 18 18 18 18 00 18 00    ................
00FD90:  6C 6C 6C 00 00 00 00 00 6C 6C FE 6C FE 6C 6C 00    lll.....ll.l.ll.
00FDA0:  18 3E 58 3C 1A 7C 18 00 00 C6 CC 18 30 66 C6 00    .>X<.|......0f..
00FDB0:  38 6C 38 76 DC CC 76 00 18 18 30 00 00 00 00 00    8l8v..v...0.....
00FDC0:  0C 18 30 30 30 18 0C 00 30 18 0C 0C 0C 18 30 00    ..000...0.....0.
00FDD0:  00 66 3C FF 3C 66 00 00 00 18 18 7E 18 18 00 00    .f<.<f.....~....
00FDE0:  00 00 00 00 00 18 18 30 00 00 00 7E 00 00 00 00    .......0...~....
00FDF0:  00 00 00 00 00 18 18 00 06 0E 00 38 70 E0 C0 00    ...........8p...
00FE00:  7C FE 06 D6 E6 FE 7C 00 18 38 00 18 18 18 7E 00    |.....|..8....~.
00FE10:  7C 7E 02 3C 60 7E 7E 00 3C 7E 02 1C 06 7E 3C 00    |~.<`~~.<~...~<.
00FE20:  1C 3C 0C FE FE 0C 0C 00 7E 7E 00 7C 06 7E 7C 00    .<......~~.|.~|.
00FE30:  3C 7E 00 7C 66 7E 3C 00 7E 7E 00 0C 18 18 18 00    <~.|f~<.~~......
00FE40:  3C 7E 66 3C 66 7E 3C 00 3C 7E 60 3E 06 7E 3C 00    <~f<f~<.<~`>.~<.
00FE50:  00 00 18 18 00 18 18 00 00 00 18 18 00 18 18 30    ...............0
00FE60:  0C 1C 00 70 38 1C 0C 00 00 00 7E 00 00 7E 00 00    ...p8.....~..~..
00FE70:  60 70 00 1C 38 30 60 00 3C 7E 60 0C 18 00 18 00    `p..80`.<~`.....
00FE80:  30 08 3C 46 66 66 3A 00 7C FE 06 C6 F6 C6 C6 00    0.<Fff:.|.......
00FE90:  FC FE 06 FC C6 FE FC 00 7C FE 00 C0 C0 FE 7C 00    ........|.....|.
00FEA0:  F8 FC 0E C6 CE FC F8 00 7C FE 00 F0 C0 FE 7C 00    ........|.....|.
00FEB0:  FE FE 00 F8 E0 E0 E0 00 7E FE 00 CE C6 FE 7E 00    ........~.....~.
00FEC0:  C6 C6 00 FE C6 C6 C6 00 7E 18 00 18 18 18 7E 00    ........~.....~.
00FED0:  1E 0C 00 0C CC FC 78 00 C6 C6 00 F8 CC C6 C6 00    ......x.........
00FEE0:  C0 C0 00 C0 C0 FE FE 00 C6 EE 00 FE D6 C6 C6 00    ................
00FEF0:  C6 E6 06 DE CE C6 C6 00 7C FE 06 C6 C6 FE 7C 00    ........|.....|.
00FF00:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00FF10:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00FF20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00FF30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00FF40:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00FF50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00FF60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00FF70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00FF80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00FF90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00FFA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00FFB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00FFC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00FFD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00FFE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
00FFF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
010000:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
010010:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
010020:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
010030:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
010040:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
010050:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
010060:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
010070:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
010080:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
010090:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0100A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0100B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0100C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0100D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0100E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0100F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
010100:  FC FE 06 C6 FC C0 C0 00 7C FE 06 C6 DA EC 76 00    ........|.....v.
010110:  FC FE 06 FC CC C6 C6 00 7C FE 80 7C 06 FE 7C 00    ........|..|..|.
010120:  FE FE 00 38 38 38 38 00 C6 C6 00 C6 C6 FE 7C 00    ...8888.......|.
010130:  C6 C6 06 EE 7C 38 10 00 C6 C6 00 D6 FE EE C6 00    ....|8..........
010140:  C6 6C 00 38 6C C6 C6 00 E6 E6 00 7E 3C 18 18 00    .l.8l......~<...
010150:  FE FE 00 18 30 7E FE 00 3C 30 00 30 30 30 3C 00    ....0~..<0.000<.
010160:  00 00 3C 46 60 3E 08 18 3C 0C 00 0C 0C 0C 3C 00    ..<F`>..<.....<.
010170:  18 24 00 00 00 00 00 00 00 00 00 00 00 00 00 FF    .$..............
010180:  30 18 0C 00 00 00 00 00 00 00 3C 46 66 6E 36 00    0.........<Ffn6.
010190:  60 60 7C 46 66 66 7C 00 00 00 3C 46 60 66 3C 00    ``|Fff|...<F`f<.
0101A0:  0C 0C 7C C4 CC CC 7C 00 00 00 3C 46 7E 60 3C 00    ..|...|...<F~`<.
0101B0:  1C 36 30 7C 20 30 30 00 00 00 3E 62 66 3E 06 3C    .60| 00...>bf>.<
0101C0:  60 60 6C 76 46 66 66 00 18 00 18 18 08 18 18 00    ``lvFff.........
0101D0:  06 00 06 06 04 66 66 3C 60 60 66 2C 78 6C 66 00    .....ff<``f,xlf.
0101E0:  18 18 18 10 18 18 3C 00 00 00 6C 96 D6 D6 C6 00    ......<...l.....
0101F0:  00 00 7C 46 66 66 66 00 00 00 3C 46 66 66 3C 00    ..|Ffff...<Fff<.
010200:  00 00 7C 46 66 7C 60 60 00 00 7C C4 CC 7C 0C 0C    ..|Ff|``..|..|..
010210:  00 00 7C 4E 60 60 60 00 00 00 3C 60 3C 06 7C 00    ..|N```...<`<.|.
010220:  30 30 7C 20 30 36 1C 00 00 00 66 46 66 66 3E 00    00| 06....fFff>.
010230:  00 00 66 46 66 3C 18 00 00 00 C6 96 D6 FE 6C 00    ..fFf<........l.
010240:  00 00 C6 68 38 6C C6 00 00 00 66 64 66 3E 06 3C    ...h8l....fdf>.<
010250:  00 00 7E 08 18 30 7E 00 06 08 3C 46 7E 60 3C 00    ..~..0~...<F~`<.
010260:  30 08 66 26 66 66 3E 00 60 10 3C 46 7E 60 3C 00    0.f&ff>.`.<F~`<.
010270:  76 DC 00 00 00 00 00 00 3C 66 60 F8 60 66 FE 00    v.......<f`.`f..
010280:  30 08 3C 46 66 66 3A 00 7C FE 06 C6 F6 C6 C6 00    0.<Fff:.|.......
010290:  FC FE 06 FC C6 FE FC 00 7C FE 00 C0 C0 FE 7C 00    ........|.....|.
0102A0:  F8 FC 0E C6 CE FC F8 00 7C FE 00 F0 C0 FE 7C 00    ........|.....|.
0102B0:  FE FE 00 F8 E0 E0 E0 00 7E FE 00 CE C6 FE 7E 00    ........~.....~.
0102C0:  C6 C6 00 FE C6 C6 C6 00 7E 18 00 18 18 18 7E 00    ........~.....~.
0102D0:  1E 0C 00 0C CC FC 78 00 C6 C6 00 F8 CC C6 C6 00    ......x.........
0102E0:  C0 C0 00 C0 C0 FE FE 00 C6 EE 00 FE D6 C6 C6 00    ................
0102F0:  C6 E6 06 DE CE C6 C6 00 7C FE 06 C6 C6 FE 7C 00    ........|.....|.
010300:  00 53 43 52 49 50 54 32 20 46 4E 54 00 00 00 00    .SCRIPT2 FNT....
010310:  00 00 02 00 00 00 7D 00 00 03 00 7D 00 00 00 00    ......}....}....
010320:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
010330:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
010340:  00 03 00 11 04 00 00 53 43 52 49 50 54 32 20 24    .......SCRIPT2 $
010350:  24 24 FF 00 FF 00 00 02 00 00 00 7D 00 00 03 00    $$.........}....
010360:  7D 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    }...............
010370:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
010380:  00 00 00 00 00 00 00 00 08 08 08 10 10 00 10 00    ................
010390:  28 28 28 00 00 00 00 00 24 24 FE 24 FE 48 48 00    (((.....$$.$.HH.
0103A0:  08 1F 28 1C 12 7C 10 00 00 62 64 08 10 26 46 00    ..(..|...bd..&F.
0103B0:  38 44 38 56 8C 88 76 00 18 08 30 00 00 00 00 00    8D8V..v...0.....
0103C0:  0C 10 20 20 20 10 0C 00 30 08 04 04 04 08 30 00    ..   ...0.....0.
0103D0:  00 66 18 FF 18 66 00 00 00 10 10 7C 10 10 00 00    .f...f.....|....
0103E0:  00 00 00 00 00 18 08 30 00 00 00 7E 00 00 00 00    .......0...~....
0103F0:  00 00 00 00 00 00 08 00 01 02 04 08 10 20 40 00    ............. @.
010400:  06 19 25 49 51 42 3C 00 04 18 08 10 10 20 60 00    ..%IQB<...... `.
010410:  1E 31 03 3C 40 42 7E 00 1E 21 03 0C 02 42 3C 00    .1.<@B~..!...B<.
010420:  07 19 22 44 7E 08 3E 00 0F 10 20 1E 01 01 3E 00    .."D~.>... ...>.
010430:  07 18 20 5E 61 41 3E 00 1F 22 02 04 04 08 08 00    .. ^aA>.."......
010440:  0E 11 21 3E 41 41 3E 00 1E 21 41 3D 02 02 3C 00    ..!>AA>..!A=..<.
010450:  00 00 08 08 00 08 08 00 00 00 08 08 00 18 08 30    ...............0
010460:  08 10 20 40 20 10 08 00 00 00 7E 00 00 7E 00 00    .. @ .....~..~..
010470:  20 10 08 04 08 10 20 00 3C 42 42 04 08 00 10 00     ..... .<BB.....
010480:  18 04 1E 01 3E 42 3D 00 08 14 12 22 3F 41 41 00    ....>B=...."?AA.
010490:  1E 11 11 2E 21 41 7E 00 07 18 20 40 40 40 3E 00    ....!A~... @@@>.
0104A0:  1E 11 11 21 21 42 7C 00 0F 10 20 58 40 40 3E 00    ...!!B|... X@@>.
0104B0:  1F 20 20 58 40 40 40 00 07 18 20 47 41 41 3E 00    .  X@@@... GAA>.
0104C0:  09 11 11 2E 22 44 44 00 04 08 08 10 10 20 20 00    ...."DD......  .
0104D0:  07 09 01 01 41 42 3C 00 09 11 12 2E 22 41 41 00    ....AB<....."AA.
0104E0:  08 10 10 20 20 41 7E 00 11 1B 15 25 21 41 41 00    ...  A~....%!AA.
0104F0:  11 19 15 25 23 41 41 00 06 19 21 41 41 42 3C 00    ...%#AA...!AAB<.
010500:  00 4E 4F 20 20 20 20 20 20 47 57 58 00 00 00 00    .NO      GWX....
010510:  00 00 02 00 00 00 96 00 07 00 00 96 00 00 00 00    ................
010520:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
010530:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
010540:  07 00 00 8F 03 C9 00 00 C9 00 00 C9 1A 20 20 24    .............  $
010550:  24 24 FF 00 FF 00 00 00 00 00 00 00 00 00 00 00    $$..............
010560:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
010570:  00 00 00 00 00 00 07 00 00 FF 03 00 0A 9D 0A 9D    ................
010580:  C9 00 00 C9 00 00 C9 1A 20 20 24 24 24 FF 00 FF    ........  $$$...
010590:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0105A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0105B0:  00 07 00 00 FF 03 00 0A 9D 0A 9D 00 44 20 20 20    ............D   
0105C0:  20 20 20 20 FF FF FF 00 00 00 00 00 00 16 00 00        ............
0105D0:  0A 9D FF 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0105E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0105F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
010600:  00 47 57 44 45 4D 4F 20 20 42 49 4E 00 00 00 46    .GWDEMO  BIN...F
010610:  96 97 98 99 9A 9B 9C 9D 9E 00 00 00 00 00 00 00    ................
010620:  00 49 4E 54 52 4F 20 20 20 44 41 54 00 00 00 0D    .INTRO   DAT....
010630:  9F A0 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
010640:  00 4C 49 4E 45 4F 55 54 20 46 4E 54 00 00 00 07    .LINEOUT FNT....
010650:  4F 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    O...............
010660:  00 47 57 2D 43 4C 49 50 20 53 43 52 00 00 00 80    .GW-CLIP SCR....
010670:  A3 A4 A5 A6 A7 A8 A9 AA AB AC AD AE AF B0 B1 B2    £...............
010680:  00 41 43 43 45 4E 54 53 20 44 41 54 00 00 00 02    .ACCENTS DAT....
010690:  A2 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0106A0:  00 47 57 2D 43 4C 49 50 20 53 43 52 01 00 00 01    .GW-CLIP SCR....
0106B0:  B3 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0106C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0106D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0106E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0106F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
010700:  1E 21 21 5E 40 40 40 00 06 19 21 41 45 42 39 00    .!!^@@@...!AEB9.
010710:  0E 11 21 5E 44 42 41 00 0E 11 20 1E 01 42 3C 00    ..!^DBA... ..B<.
010720:  3F 08 08 10 10 20 20 00 11 11 11 22 22 44 38 00    ?....  ....""D8.
010730:  11 11 11 22 22 14 08 00 41 41 49 49 2A 36 22 00    ...""...AAII*6".
010740:  63 14 18 28 44 82 82 00 11 11 11 12 0C 08 18 00    c..(D...........
010750:  3F 02 04 08 10 20 7E 00 1C 10 10 20 20 20 3C 00    ?.... ~....   <.
010760:  00 00 1E 21 20 1E 08 30 1C 04 04 08 08 08 38 00    ...! ..0......8.
010770:  18 24 00 00 00 00 00 00 00 00 00 00 00 00 00 FF    .$..............
010780:  20 10 08 00 00 00 00 00 00 00 1E 01 3E 42 3D 00     ...........>B=.
010790:  10 10 3E 21 41 42 7C 00 00 00 1E 21 40 42 3C 00    ..>!AB|....!@B<.
0107A0:  02 02 3C 44 88 88 74 00 00 00 1E 21 7E 40 3C 00    ..<D..t....!~@<.
0107B0:  0C 12 10 78 20 20 20 00 00 00 1F 21 21 1F 02 3C    ...x   ....!!..<
0107C0:  20 20 3C 22 22 44 44 00 08 00 08 08 10 10 30 00      <""DD.......0.
0107D0:  02 00 06 02 02 44 44 38 10 10 12 24 38 24 42 00    .....DD8...$8$B.
0107E0:  08 08 10 10 10 20 20 00 00 00 36 5A 52 94 84 00    .....  ...6ZR...
0107F0:  00 00 1C 22 22 44 44 00 00 00 1E 21 41 42 3C 00    ...""DD....!AB<.
010800:  00 00 3E 21 21 7E 40 40 00 00 3D 42 42 3C 04 04    ..>!!~@@..=BB<..
010810:  00 00 1E 23 40 40 40 00 00 00 1E 20 1C 02 3C 00    ...#@@@.... ..<.
010820:  10 10 7C 20 20 22 1C 00 00 00 22 22 44 44 38 00    ..|  "....""DD8.
010830:  00 00 22 22 24 14 08 00 00 00 21 29 4A 5A 6C 00    ..""$.....!)JZl.
010840:  00 00 42 24 38 48 84 00 00 00 21 21 22 1E 04 38    ..B$8H....!!"..8
010850:  00 00 3E 04 18 20 7C 00 03 04 1E 21 7E 40 3C 00    ..>.. |....!~@<.
010860:  30 08 22 22 44 44 38 00 30 08 1E 21 7E 40 3C 00    0.""DD8.0..!~@<.
010870:  36 48 00 00 00 00 00 00 1E 23 20 F0 40 46 FC 00    6H.......# .@F..
010880:  18 04 1E 01 3E 42 3D 00 08 14 12 22 3F 41 41 00    ....>B=...."?AA.
010890:  1E 11 11 2E 21 41 7E 00 07 18 20 40 40 40 3E 00    ....!A~... @@@>.
0108A0:  1E 11 11 21 21 42 7C 00 0F 10 20 58 40 40 3E 00    ...!!B|... X@@>.
0108B0:  1F 20 20 58 40 40 40 00 07 18 20 47 41 41 3E 00    .  X@@@... GAA>.
0108C0:  09 11 11 2E 22 44 44 00 04 08 08 10 10 20 20 00    ...."DD......  .
0108D0:  07 09 01 01 41 42 3C 00 09 11 12 2E 22 41 41 00    ....AB<....."AA.
0108E0:  08 10 10 20 20 41 7E 00 11 1B 15 25 21 41 41 00    ...  A~....%!AA.
0108F0:  11 19 15 25 23 41 41 00 06 19 21 41 41 42 3C 00    ...%#AA...!AAB<.
010900:  3A 7B 92 FE FB CA 7C 92 CD 03 60 C3 D5 90 06 04    :{....|...`.....
010910:  00 10 FD 01 10 7F 3A 03 90 ED 49 ED 79 0E 00 ED    ......:...I.y...
010920:  49 ED 79 21 F0 FF 23 7C A7 20 FB 3E 54 0E 10 ED    I.y!..#|. .>T...
010930:  49 ED 79 0E 00 ED 49 ED 79 C9 2A 26 90 7E FE FF    I.y...I.y.*&.~..
010940:  CA 18 92 23 22 26 90 21 BC C1 01 4A 00 09 D6 08    ...#"&.!...J....
010950:  30 FB C6 08 01 00 08 A7 28 04 09 3D 20 FC 0E 00    0.......(..= ...
010960:  3A 18 90 A7 28 02 0E 0F 06 08 7E A1 77 23 7E A1    :...(.....~.w#~.
010970:  77 23 7E A1 77 23 7E A1 77 23 7E A1 77 23 7E A1    w#~.w#~.w#~.w#~.
010980:  77 23 7E A1 77 23 7E A1 77 23 7E A1 77 23 10 DA    w#~.w#~.w#~.w#..
010990:  7E A1 77 23 7E A1 77 C9 AF 32 28 90 32 19 90 21    ~.w#~.w..2(.2..!
0109A0:  60 8F 22 26 90 C9 3E 30 21 00 7E 11 00 C0 01 4A    `."&..>0!.~....J
0109B0:  00 ED B0 EB 01 B6 07 09 30 04 01 4A C0 09 EB 3D    ........0..J...=
0109C0:  20 EC C9 21 7A 92 01 0E F4 ED 49 01 C0 F6 ED 49     ..!z.....I....I
0109D0:  AF ED 79 01 92 F7 ED 49 0E 45 06 F6 ED 49 06 F4    ..y....I.E...I..
0109E0:  ED 78 77 23 0E 48 06 F6 ED 49 06 F4 ED 78 77 01    .xw#.H...I...xw.
0109F0:  82 F7 ED 49 01 00 F6 ED 49 C9 00 00 F3 01 01 BC    ...I....I.......
010A00:  ED 49 01 28 BD ED 49 01 02 BC ED 49 01 2E BD ED    .I.(..I....I....
010A10:  49 01 06 BC ED 49 01 19 BD ED 49 01 07 BC ED 49    I....I....I....I
010A20:  01 1E BD ED 49 01 05 BC ED 49 01 00 BD ED 49 2A    ....I....I....I*
010A30:  29 90 22 38 00 08 F1 08 CD 94 93 FB C3 A7 BC E1    )."8............
010A40:  06 2F 10 FE 3E 12 1E 0D 01 01 7F DD 21 1A 90 ED    ./..>.......!...
010A50:  49 08 DD 7E 00 ED 79 00 00 00 7B 3D 20 FD DD 7E    I..~..y...{= ..~
010A60:  01 ED 79 00 00 00 7B 3D 20 FD DD 7E 02 ED 79 00    ..y...{= ..~..y.
010A70:  00 00 7B 3D 20 FD DD 7E 03 ED 79 00 00 00 7B 3D    ..{= ..~..y...{=
010A80:  20 FD DD 7E 04 ED 79 00 00 00 7B 3D 20 FD DD 7E     ..~..y...{= ..~
010A90:  05 ED 79 00 00 00 7B 3D 20 FD DD 7E 06 ED 79 00    ..y...{= ..~..y.
010AA0:  00 00 7B 3D 20 FD DD 7E 07 ED 79 7B 3D 3D 20 FD    ..{= ..~..y{== .
010AB0:  08 3D 20 9D 3E 54 ED 79 C3 5D 91 54 54 54 50 50    .= .>T.y.].TTTPP
010AC0:  50 55 55 55 53 53 53 49 49 49 4B 4B 4B 4B 4B 4B    PUUUSSSIIIKKKKKK
010AD0:  49 49 49 53 53 53 55 55 55 50 50 50 54 54 54 00    IIISSSUUUPPPTTT.
010AE0:  3A 24 90 A7 C8 3A 19 90 FE FF 20 19 3A 28 90 A7    :$...:.... .:(..
010AF0:  20 13 2A 92 93 7E A7 20 04 21 3B 93 7E 32 75 91     .*..~. .!;.~2u.
010B00:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
010B10:  0E 00 01 00 02 09 50 E5 0E 00 C1 02 00 00 00 02    ......P.........
010B20:  0E 00 C6 02 00 00 00 02 0E 00 C2 02 00 00 00 02    ................
010B30:  0E 00 C7 02 00 00 00 02 0E 00 C3 02 00 00 00 02    ................
010B40:  0E 00 C8 02 00 00 00 02 0E 00 C4 02 00 00 00 02    ................
010B50:  0E 00 C9 02 00 00 00 02 0E 00 C5 02 00 00 00 02    ................
010B60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
010B70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
010B80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
010B90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
010BA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
010BB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
010BC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
010BD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
010BE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
010BF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
010C00:  00 53 51 55 41 52 45 20 20 46 4E 54 00 00 00 00    .SQUARE  FNT....
010C10:  00 00 02 00 00 00 7D 00 00 03 00 7D 00 00 00 00    ......}....}....
010C20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
010C30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
010C40:  00 03 00 FB 03 00 00 53 51 55 41 52 45 20 20 24    .......SQUARE  $
010C50:  24 24 FF 00 FF 00 00 02 00 00 00 40 00 00 40 00    $$.........@..@.
010C60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
010C70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
010C80:  00 00 00 00 00 00 00 00 18 18 18 18 18 00 18 00    ................
010C90:  6C 6C 6C 00 00 00 00 00 6C 6C FE 6C FE 6C 6C 00    lll.....ll.l.ll.
010CA0:  18 3E 58 3C 1A 7C 18 00 00 C6 CC 18 30 66 C6 00    .>X<.|......0f..
010CB0:  38 6C 38 76 DC CC 76 00 18 18 30 00 00 00 00 00    8l8v..v...0.....
010CC0:  0C 18 30 30 30 18 0C 00 30 18 0C 0C 0C 18 30 00    ..000...0.....0.
010CD0:  00 66 3C FF 3C 66 00 00 00 18 18 7E 18 18 00 00    .f<.<f.....~....
010CE0:  00 00 00 00 00 18 18 30 00 00 00 7E 00 00 00 00    .......0...~....
010CF0:  00 00 00 00 00 18 18 00 06 0C 18 30 60 C0 80 00    ...........0`...
010D00:  FE C6 CE D6 E6 C6 FE 00 18 38 18 18 18 18 18 00    .........8......
010D10:  7E 66 06 7E 60 66 7E 00 7E 66 06 1C 06 66 7E 00    ~f.~`f~.~f...f~.
010D20:  1C 3C 6C CC FE 0C 0C 00 7E 66 60 7E 06 66 7E 00    .<l.....~f`~.f~.
010D30:  7E 66 60 7E 66 66 7E 00 7E 66 06 06 06 06 06 00    ~f`~ff~.~f......
010D40:  7E 66 66 3C 66 66 7E 00 7E 66 66 7E 06 66 7E 00    ~ff<ff~.~ff~.f~.
010D50:  00 00 18 18 00 18 18 00 00 00 18 18 00 18 18 30    ...............0
010D60:  0C 18 30 60 30 18 0C 00 00 00 7E 00 00 7E 00 00    ..0`0.....~..~..
010D70:  60 30 18 0C 18 30 60 00 7E 66 66 0C 18 00 18 00    `0...0`.~ff.....
010D80:  60 10 F8 0C FC 8C FC 00 FE C6 C6 C6 FE C6 C6 00    `...............
010D90:  FE C6 C6 FC C6 C6 FE 00 FE C6 C0 C0 C0 C6 FE 00    ................
010DA0:  FC C6 C6 C6 C6 C6 FC 00 FE C6 C0 F0 C0 C6 FE 00    ................
010DB0:  FE C6 C0 F0 C0 C0 C0 00 FE C6 C0 CE C6 C6 FE 00    ................
010DC0:  C6 C6 C6 FE C6 C6 C6 00 7E 18 18 18 18 18 7E 00    ........~.....~.
010DD0:  1E 06 06 06 C6 C6 FE 00 C6 C6 C6 FC C6 C6 C6 00    ................
010DE0:  C0 C0 C0 C0 C0 C6 FE 00 FE FE D6 D6 D6 C6 C6 00    ................
010DF0:  C6 E6 F6 DE CE C6 C6 00 FE C6 C6 C6 C6 C6 FE 00    ................
010E00:  7E DD 77 19 E1 3E 01 CB 7E 20 0D 23 7E CB 7F 28    ~.w..>..~ .#~..(
010E10:  07 E6 7F DD 77 06 18 53 DD 77 06 23 E5 7E F5 E6    ....w..S.w.#.~..
010E20:  0F DD BE 05 28 06 DD 77 05 DD 72 0A 87 87 87 5F    ....(..w..r...._
010E30:  21 42 64 19 50 59 ED A0 ED A0 ED A0 ED A0 ED A0    !Bd.PY..........
010E40:  ED A0 ED A0 ED A0 F1 E1 E6 F0 28 1F FE F0 CA A0    ..........(.....
010E50:  62 FE D0 CA BC 62 FE B0 CA C4 62 FE 80 D2 CC 62    b....b....b....b
010E60:  FE 10 20 07 AF DD 77 1B DD 77 09 23 DD 75 00 DD    .. ...w..w.#.u..
010E70:  74 01 DD 36 16 00 DD 36 17 20 DD 7E 17 B7 20 0E    t..6...6. .~.. .
010E80:  DD 7E 15 B7 C8 DD 77 17 DD 7E 14 DD 77 16 16 00    .~....w..~..w...
010E90:  DD 5E 16 DD 34 16 DD 35 17 DD 7E 1B B7 28 1A 67    .^..4..5..~..(.g
010EA0:  DD 6E 1A 19 7E DD 46 07 80 87 42 4F 21 0C 63 09    .n..~.F...BO!.c.
010EB0:  7E DD 77 18 23 7E DD 77 19 DD 66 0F DD 6E 0E 19    ~.w.#~.w..f..n..
010EC0:  19 4E 23 46 DD 6E 18 DD 66 19 09 4D DD 7E 02 CD    .N#F.n..f..M.~..
010ED0:  E4 62 4C DD 7E 03 CD E4 62 DD 66 11 DD 6E 10 19    .bL.~...b.f..n..
010EE0:  7E CB 7F 20 12 E6 0F DD 96 0A 30 01 AF DD B6 09    ~.. ......0.....
010EF0:  4F DD 7E 04 CD E4 62 DD 6E 12 DD 66 13 19 7E CB    O.~...b.n..f..~.
010F00:  7F C0 E6 1F DD 46 0B 4F B7 78 28 08 47 79 32 CF    .....F.O.x(.Gy2.
010F10:  60 78 D6 40 32 9B 62 3A C0 60 CB 47 32 C0 60 C9    `x.@2.b:.`.G2.`.
010F20:  23 7E E5 87 06 00 4F 21 C2 64 09 5E 23 56 DD 73    #~....O!.d.^#V.s
010F30:  1A DD 72 1B DD 36 09 00 E1 C3 EB 61 23 7E 32 BB    ..r..6.....a#~2.
010F40:  60 C3 EB 61 23 7E DD 77 0A C3 EB 61 DD 36 09 10    `..a#~.w...a.6..
010F50:  DD 36 1B 00 7E 0F 0F 0F 0F 32 ED 60 23 7E 32 DE    .6..~....2.`#~2.
010F60:  60 C3 EB 61 06 F4 ED 79 06 F6 ED 78 F6 C0 ED 79    `..a...y...x...y
010F70:  E6 3F ED 79 06 F4 ED 49 06 F6 4F F6 80 ED 79 ED    .?.y...I..O...y.
010F80:  49 C9 FF FF FF FF A2 66 CC 66 F6 66 EE 0E 18 0E    I......f.f.f....
010F90:  4D 0D 8E 0C DA 0B 2F 0B 8F 0A F7 09 68 09 E1 08    M...../.....h...
010FA0:  61 08 E9 07 77 07 0C 07 A7 06 47 06 ED 05 98 05    a...w.....G.....
010FB0:  47 05 FC 04 B4 04 70 04 31 04 F4 03 BC 03 86 03    G.....p.1.......
010FC0:  53 03 24 03 F6 02 CC 02 A4 02 7E 02 5A 02 38 02    S.$.......~.Z.8.
010FD0:  18 02 FA 01 DE 01 C3 01 AA 01 92 01 7B 01 66 01    ............{.f.
010FE0:  52 01 3F 01 2D 01 1C 01 0C 01 FD 00 EF 00 E1 00    R.?.-...........
010FF0:  D5 00 C9 00 BE 00 B3 00 A9 00 9F 00 96 00 8E 00    ................
011000:  FE C6 C6 FE C0 C0 C0 00 FE C6 C6 C6 DA CC F6 00    ................
011010:  FE C6 C6 FC CC C6 C6 00 FE C6 C0 FE 06 C6 FE 00    ................
011020:  7E 5A 18 18 18 18 18 00 C6 C6 C6 C6 C6 C6 FE 00    ~Z..............
011030:  C6 C6 C6 C6 EE 7C 10 00 C6 C6 D6 D6 D6 FE FE 00    .....|..........
011040:  C6 6C 38 38 6C C6 C6 00 66 66 66 3C 18 18 18 00    .l88l...fff<....
011050:  FE C6 0C 18 30 66 FE 00 3C 30 30 30 30 30 3C 00    ....0f..<00000<.
011060:  00 00 7E 66 60 7E 08 18 3C 0C 0C 0C 0C 0C 3C 00    ..~f`~..<.....<.
011070:  18 24 00 00 00 00 00 00 00 00 00 00 00 00 00 FF    .$..............
011080:  30 18 0C 00 00 00 00 00 00 00 FC 0C FC 8C FC 00    0...............
011090:  60 60 7E 66 66 66 7E 00 00 00 7E 66 60 66 7E 00    ``~fff~...~f`f~.
0110A0:  0C 0C FC CC CC CC FC 00 00 00 7E 66 7E 60 7E 00    ..........~f~`~.
0110B0:  3E 36 30 30 38 30 30 00 00 00 7E 66 66 7E 06 7E    >600800...~ff~.~
0110C0:  60 60 60 7E 66 66 66 00 18 00 18 18 18 18 18 00    ```~fff.........
0110D0:  06 00 0E 06 06 66 66 7E 60 60 66 6C 78 6C 66 00    .....ff~``flxlf.
0110E0:  18 18 18 18 18 18 18 00 00 00 FE D6 D6 C6 C6 00    ................
0110F0:  00 00 7E 66 66 66 66 00 00 00 7E 66 66 66 7E 00    ..~ffff...~fff~.
011100:  00 00 7E 66 66 7E 60 60 00 00 FC CC CC FC 0C 0C    ..~ff~``........
011110:  00 00 7E 66 60 60 60 00 00 00 7E 60 7E 06 7E 00    ..~f```...~`~.~.
011120:  30 30 3C 30 30 30 3C 00 00 00 66 66 66 66 7E 00    00<000<...ffff~.
011130:  00 00 66 66 66 3C 18 00 00 00 C6 C6 D6 D6 FE 00    ..fff<..........
011140:  00 00 C6 6C 38 6C C6 00 00 00 66 66 66 7E 06 7E    ...l8l....fff~.~
011150:  00 00 7E 0C 18 30 7E 00 06 08 7E 66 7E 60 7E 00    ..~..0~...~f~`~.
011160:  30 08 66 66 66 66 7E 00 60 10 7E 66 7E 60 7E 00    0.ffff~.`.~f~`~.
011170:  76 DC 00 00 00 00 00 00 3C 66 60 F8 60 66 FE 00    v.......<f`.`f..
011180:  60 10 F8 0C FC 8C FC 00 FE C6 C6 C6 FE C6 C6 00    `...............
011190:  FE C6 C6 FC C6 C6 FE 00 FE C6 C0 C0 C0 C6 FE 00    ................
0111A0:  FC C6 C6 C6 C6 C6 FC 00 FE C6 C0 F0 C0 C6 FE 00    ................
0111B0:  FE C6 C0 F0 C0 C0 C0 00 FE C6 C0 CE C6 C6 FE 00    ................
0111C0:  C6 C6 C6 FE C6 C6 C6 00 7E 18 18 18 18 18 7E 00    ........~.....~.
0111D0:  1E 06 06 06 C6 C6 FE 00 C6 C6 C6 FC C6 C6 C6 00    ................
0111E0:  C0 C0 C0 C0 C0 C6 FE 00 FE FE D6 D6 D6 C6 C6 00    ................
0111F0:  C6 E6 F6 DE CE C6 C6 00 FE C6 C6 C6 C6 C6 FE 00    ................
011200:  86 00 7F 00 77 00 71 00 6A 00 64 00 5F 00 59 00    ....w.q.j.d._.Y.
011210:  54 00 50 00 4B 00 47 00 43 00 3F 00 3C 00 38 00    T.P.K.G.C.?.<.8.
011220:  35 00 32 00 2F 00 2D 00 2A 00 28 00 26 00 24 00    5.2./.-.*.(.&.$.
011230:  22 00 20 00 1E 00 1C 00 1B 00 19 00 18 00 16 00    ". .............
011240:  15 00 14 00 13 00 12 00 11 00 10 00 0F 00 00 00    ................
011250:  00 00 00 00 00 00 00 00 00 00 00 00 00 01 08 00    ................
011260:  00 00 00 00 00 DF 00 00 00 00 00 00 00 00 00 00    ................
011270:  00 00 00 00 00 00 00 00 02 03 09 00 00 00 00 00    ................
011280:  00 E7 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
011290:  00 00 00 00 04 05 0A 00 00 00 00 00 00 EF 00 00    ................
0112A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0112B0:  00 00 00 00 00 00 00 00 53 54 2D 4D 6F 64 75 6C    ........ST-Modul
0112C0:  65 2E E2 64 22 65 42 65 10 10 62 65 A2 65 C2 65    e..d"eBe..be.e.e
0112D0:  00 00 E2 64 E2 65 42 65 10 10 02 66 42 66 42 65    ...d.eBe...fBfBe
0112E0:  08 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
0112F0:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
011300:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
011310:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
011320:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
011330:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
011340:  00 00 62 66 DC 5E DC 5E 82 66 DC 5E DC 5E DC 5E    ..bf.^.^.f.^.^.^
011350:  DC 5E DC 5E DC 5E DC 5E DC 5E DC 5E DC 5E DC 5E    .^.^.^.^.^.^.^.^
011360:  DC 5E 01 00 01 00 01 00 01 00 00 00 00 00 00 00    .^..............
011370:  00 00 01 00 01 00 01 00 01 00 00 00 00 00 00 00    ................
011380:  00 00 01 00 01 00 01 00 01 00 00 00 00 00 00 00    ................
011390:  00 00 01 00 01 00 01 00 01 00 00 00 00 00 00 00    ................
0113A0:  00 00 0F 0E 0D 0C 80 80 80 80 80 80 80 80 80 80    ................
0113B0:  80 80 80 80 80 80 80 80 80 80 80 80 80 80 80 80    ................
0113C0:  80 80 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0113D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0113E0:  00 00 80 00 00 01 80 01 00 02 80 02 00 03 00 04    ................
0113F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
011400:  00 53 59 53 2D 46 52 20 20 46 4E 54 00 00 00 00    .SYS-FR  FNT....
011410:  00 00 02 00 00 00 90 00 00 03 00 00 00 00 00 00    ................
011420:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
011430:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
011440:  00 03 00 84 03 00 00 53 59 53 2D 46 52 20 20 24    .......SYS-FR  $
011450:  24 24 FF 00 FF CB 20 03 00 00 73 61 76 65 66 69    $$.... ...savefi
011460:  6C E5 2C 0D 00 00 E2 2C 0D 00 00 66 6F 6E 74 E5    l.,....,...font.
011470:  2C 0D 00 00 61 64 F2 F5 1C 00 90 00 00 00 1A 2E    ,...ad..........
011480:  00 00 00 00 00 00 00 00 18 18 18 18 18 00 18 00    ................
011490:  6C 6C 6C 00 00 00 00 00 6C 6C FE 6C FE 6C 6C 00    lll.....ll.l.ll.
0114A0:  18 3E 58 3C 1A 7C 18 00 00 C6 CC 18 30 66 C6 00    .>X<.|......0f..
0114B0:  38 6C 38 76 DC CC 76 00 18 18 30 00 00 00 00 00    8l8v..v...0.....
0114C0:  0C 18 30 30 30 18 0C 00 30 18 0C 0C 0C 18 30 00    ..000...0.....0.
0114D0:  00 66 3C FF 3C 66 00 00 00 18 18 7E 18 18 00 00    .f<.<f.....~....
0114E0:  00 00 00 00 00 18 18 30 00 00 00 7E 00 00 00 00    .......0...~....
0114F0:  00 00 00 00 00 18 18 00 06 0C 18 30 60 C0 80 00    ...........0`...
011500:  7C C6 CE D6 E6 C6 7C 00 18 38 18 18 18 18 7E 00    |.....|..8....~.
011510:  3C 66 06 3C 60 66 7E 00 3C 66 06 1C 06 66 3C 00    <f.<`f~.<f...f<.
011520:  1C 3C 6C CC FE 0C 1E 00 7E 62 60 7C 06 66 3C 00    .<l.....~b`|.f<.
011530:  3C 66 60 7C 66 66 3C 00 7E 66 06 0C 18 18 18 00    <f`|ff<.~f......
011540:  3C 66 66 3C 66 66 3C 00 3C 66 66 3E 06 66 3C 00    <ff<ff<.<ff>.f<.
011550:  00 00 18 18 00 18 18 00 00 00 18 18 00 18 18 30    ...............0
011560:  0C 18 30 60 30 18 0C 00 00 00 7E 00 00 7E 00 00    ..0`0.....~..~..
011570:  60 30 18 0C 18 30 60 00 3C 66 66 0C 18 00 18 00    `0...0`.<ff.....
011580:  60 10 78 0C 7C CC 76 00 18 3C 66 66 7E 66 66 00    `.x.|.v..<ff~ff.
011590:  FC 66 66 7C 66 66 FC 00 3C 66 C0 C0 C0 66 3C 00    .ff|ff..<f...f<.
0115A0:  F8 6C 66 66 66 6C F8 00 FE 62 68 78 68 62 FE 00    .lfffl...bhxhb..
0115B0:  FE 62 68 78 68 60 F0 00 3C 66 C0 C0 CE 66 3E 00    .bhxh`..<f...f>.
0115C0:  66 66 66 7E 66 66 66 00 7E 18 18 18 18 18 7E 00    fff~fff.~.....~.
0115D0:  1E 0C 0C 0C CC CC 78 00 E6 66 6C 78 6C 66 E6 00    ......x..flxlf..
0115E0:  F0 60 60 60 62 66 FE 00 C6 EE FE FE D6 C6 C6 00    .```bf..........
0115F0:  C6 E6 F6 DE CE C6 C6 00 38 6C C6 C6 C6 6C 38 00    ........8l...l8.
011600:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
011610:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
011620:  00 00 0F 0F 0E 0E 0D 0C 00 00 00 00 00 00 00 00    ................
011630:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
011640:  00 00 06 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
011650:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
011660:  00 00 0F 0F 0E 0E 80 80 80 80 80 80 80 80 80 80    ................
011670:  80 80 80 80 80 80 80 80 80 80 80 80 80 80 80 80    ................
011680:  80 80 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
011690:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0116A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0116B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0116C0:  00 00 0F 0E 0D 0C 0B 0A 0A 0A 0A 0A 0A 0A 0A 0A    ................
0116D0:  0A 0A 0A 0A 0A 0A 0A 0A 0A 08 09 09 09 07 08 08    ................
0116E0:  0A 09 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0116F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
011700:  00 00 02 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
011710:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
011720:  00 00 00 20 67 00 20 67 00 20 67 00 20 67 00 20    ... g. g. g. g. 
011730:  67 00 20 67 00 62 67 02 EF 67 02 EF 67 02 EF 67    g. g.bg..g..g..g
011740:  02 EF 67 02 EF 67 02 EF 67 80 A2 66 00 33 68 00    ..g..g..g..f.3h.
011750:  51 68 00 65 68 00 7A 68 00 7A 68 00 A0 68 00 B8    Qh.eh.zh.zh..h..
011760:  68 02 B8 68 02 B8 68 02 D2 68 02 F6 68 02 D2 68    h..h..h..h..h..h
011770:  02 B8 68 80 CC 66 00 20 69 00 79 69 00 2A 6A 00    ..h..f. i.yi.*j.
011780:  79 69 00 79 69 00 79 69 00 DB 6A 02 68 6B 02 68    yi.yi.yi..j.hk.h
011790:  6B 02 19 6C 02 68 6B 02 19 6C 02 68 6B 80 F6 66    k..l.hk..l.hk..f
0117A0:  31 02 00 3D 82 38 82 31 82 40 82 31 82 3F 82 3D    1..=.8.1.@.1.?.=
0117B0:  82 31 82 3D 82 38 82 31 82 40 82 31 82 3F 82 3D    .1.=.8.1.@.1.?.=
0117C0:  82 34 82 3D 82 38 82 34 82 40 82 34 82 3F 82 3D    .4.=.8.4.@.4.?.=
0117D0:  82 36 82 3D 82 39 82 36 82 40 82 36 82 3F 82 3D    .6.=.9.6.@.6.?.=
0117E0:  82 FF C9 B3 0F 49 02 B3 00 C9 B3 0F 49 02 B3 00    .....I......I...
0117F0:  C9 B3 0F 49 02 B3 00 C9 B3 0F 49 02 B3 00 C9 B3    ...I......I.....
011800:  FC 66 66 7C 60 60 F0 00 38 6C C6 C6 DA CC 76 00    .ff|``..8l....v.
011810:  FC 66 66 7C 6C 66 E6 00 3C 66 60 3C 06 66 3C 00    .ff|lf..<f`<.f<.
011820:  7E 5A 18 18 18 18 3C 00 66 66 66 66 66 66 3C 00    ~Z....<.ffffff<.
011830:  66 66 66 66 66 3C 18 00 C6 C6 C6 D6 FE EE C6 00    fffff<..........
011840:  C6 6C 38 38 6C C6 C6 00 66 66 66 3C 18 18 3C 00    .l88l...fff<..<.
011850:  FE C6 8C 18 32 66 FE 00 3C 30 30 30 30 30 3C 00    ....2f..<00000<.
011860:  00 00 3C 66 60 3E 08 18 3C 0C 0C 0C 0C 0C 3C 00    ..<f`>..<.....<.
011870:  18 24 00 00 00 00 00 00 00 00 00 00 00 00 00 FF    .$..............
011880:  30 18 0C 00 00 00 00 00 00 00 78 0C 7C CC 76 00    0.........x.|.v.
011890:  E0 60 7C 66 66 66 DC 00 00 00 3C 66 60 66 3C 00    .`|fff....<f`f<.
0118A0:  1C 0C 7C CC CC CC 76 00 00 00 3C 66 7E 60 3C 00    ..|...v...<f~`<.
0118B0:  1C 36 30 78 30 30 78 00 00 00 3E 66 66 3E 06 7C    .60x00x...>ff>.|
0118C0:  E0 60 6C 76 66 66 E6 00 18 00 38 18 18 18 3C 00    .`lvff....8...<.
0118D0:  06 00 0E 06 06 66 66 3C E0 60 66 6C 78 6C E6 00    .....ff<.`flxl..
0118E0:  38 18 18 18 18 18 3C 00 00 00 6C FE D6 D6 C6 00    8.....<...l.....
0118F0:  00 00 DC 66 66 66 66 00 00 00 3C 66 66 66 3C 00    ...ffff...<fff<.
011900:  00 00 DC 66 66 7C 60 F0 00 00 76 CC CC 7C 0C 1E    ...ff|`...v..|..
011910:  00 00 DC 76 60 60 F0 00 00 00 3C 60 3C 06 7C 00    ...v``....<`<.|.
011920:  30 30 7C 30 30 36 1C 00 00 00 66 66 66 66 3E 00    00|006....ffff>.
011930:  00 00 66 66 66 3C 18 00 00 00 C6 D6 D6 FE 6C 00    ..fff<........l.
011940:  00 00 C6 6C 38 6C C6 00 00 00 66 66 66 3E 06 7C    ...l8l....fff>.|
011950:  00 00 7E 4C 18 32 7E 00 06 08 3C 66 7E 60 3C 00    ..~L.2~...<f~`<.
011960:  30 08 66 66 66 66 3E 00 60 10 3C 66 7E 60 3C 00    0.ffff>.`.<f~`<.
011970:  76 DC 00 00 00 00 00 00 CC 33 CC 33 CC 33 CC 33    v........3.3.3.3
011980:  60 10 78 0C 7C CC 76 00 18 3C 66 66 7E 66 66 00    `.x.|.v..<ff~ff.
011990:  FC 66 66 7C 66 66 FC 00 3C 66 C0 C0 C0 66 3C 00    .ff|ff..<f...f<.
0119A0:  F8 6C 66 66 66 6C F8 00 FE 62 68 78 68 62 FE 00    .lfffl...bhxhb..
0119B0:  FE 62 68 78 68 60 F0 00 3C 66 C0 C0 CE 66 3E 00    .bhxh`..<f...f>.
0119C0:  66 66 66 7E 66 66 66 00 7E 18 18 18 18 18 7E 00    fff~fff.~.....~.
0119D0:  1E 0C 0C 0C CC CC 78 00 E6 66 6C 78 6C 66 E6 00    ......x..flxlf..
0119E0:  F0 60 60 60 62 66 FE 00 C6 EE FE FE D6 C6 C6 00    .```bf..........
0119F0:  C6 E6 F6 DE CE C6 C6 00 38 6C C6 C6 C6 6C 38 00    ........8l...l8.
011A00:  0F 49 03 B3 00 C7 B3 0F 47 02 B3 00 C7 B3 0F 47    .I......G......G
011A10:  02 B3 00 C7 B3 0F 47 02 B3 00 C7 B3 0F 47 02 B3    ......G......G..
011A20:  00 C7 B3 0F 47 03 B3 00 CC B3 0F 4C 02 B3 00 CC    ....G......L....
011A30:  B3 0F 4C 02 B3 00 CC B3 0F 4C 02 B3 00 CC B3 0F    ..L......L......
011A40:  4C 02 B3 00 CC B3 0F 4C 03 B3 00 CE B3 0F 4E 02    L......L......N.
011A50:  B3 00 CE B3 0F 4E 02 B3 00 CE B3 0F 4E 02 B3 00    .....N......N...
011A60:  CE B3 0F 4E 02 B3 00 CE B3 0F 4E 03 B3 00 FF 31    ...N......N....1
011A70:  02 B0 01 3D 02 00 38 82 31 82 40 82 31 82 3F 82    ...=..8.1.@.1.?.
011A80:  3D 82 31 82 3D 82 38 82 31 82 40 82 31 82 3F 82    =.1.=.8.1.@.1.?.
011A90:  3D 82 34 82 3D 82 38 82 34 82 40 82 34 82 3F 82    =.4.=.8.4.@.4.?.
011AA0:  3D 82 36 82 3D 82 39 82 36 82 40 82 36 82 3F 82    =.6.=.9.6.@.6.?.
011AB0:  3D 82 FF 50 08 F2 00 4E 82 4C 82 4E 82 50 8A 4E    =..P...N.L.N.P.N
011AC0:  02 02 4C 82 4E 83 50 89 4E 82 4C 82 4E 82 50 92    ..L.N.P.N.L.N.P.
011AD0:  FF 49 0C 02 4B 82 47 8F C9 02 4B 82 4C 90 4E 8C    .I..K.G...K.L.N.
011AE0:  4C 82 4B 82 FF 49 0C F2 00 4B 02 02 47 8F C9 02    L.K..I...K..G...
011AF0:  4B 82 4C 8C 4E 02 00 53 92 FF 50 04 02 4E 82 4C    K.L.N..S..P..N.L
011B00:  86 4E 82 4B 8C 4B 82 CC 02 4E 83 50 84 53 82 50    .N.K.K...N.P.S.P
011B10:  86 CE 02 D0 02 51 86 50 82 4E 84 4C 82 4E 84 FF    .....Q.P.N.L.N..
011B20:  49 08 02 50 84 51 82 50 92 47 88 4E 84 50 82 4E    I..P.Q.P.G.N.P.N
011B30:  86 4C 82 4B 84 47 86 FF 49 08 F2 03 50 04 02 51    .L.K.G..I...P..Q
011B40:  82 50 92 47 88 4E 84 50 82 4E 86 4C 82 4B 84 47    .P.G.N.P.N.L.K.G
011B50:  86 FF 49 04 02 44 82 49 86 44 82 47 88 42 82 44    ..I..D.I.D.G.B.D
011B60:  82 47 86 4C 84 47 82 4C 86 47 82 4E 88 50 82 4E    .G.L.G.L.G.N.P.N
011B70:  82 4C 82 49 84 FF 50 04 02 53 82 50 86 53 82 4E    .L.I..P..S.P.S.N
011B80:  88 4C 82 4E 82 50 82 53 82 D0 02 53 83 55 84 53    .L.N.P.S...S.U.S
011B90:  82 50 84 4E 02 03 4E 04 02 50 84 4C 86 4C 84 FF    .P.N..N..P.L.L..
011BA0:  C9 F0 00 49 02 00 C9 00 49 82 C9 00 49 82 C9 00    ...I....I...I...
011BB0:  49 82 C9 00 49 83 C7 F0 00 47 02 00 C7 00 47 82    I...I....G....G.
011BC0:  C7 00 47 82 C7 00 47 82 C7 00 47 83 CC F0 00 4C    ..G...G...G....L
011BD0:  02 00 CC 00 4C 82 CC 00 4C 82 CC 00 4C 82 CC 00    ....L...L...L...
011BE0:  4C 83 CE F0 00 4E 02 00 CE 00 4E 82 CE 00 4E 82    L....N....N...N.
011BF0:  CE 00 4E 82 CE 00 4E 83 FF A5 F1 00 C9 F0 00 BD    ..N...N.........
011C00:  00 57 41 4C 45 53 20 20 20 4D 55 53 00 00 00 00    .WALES   MUS....
011C10:  00 00 02 00 00 00 60 00 CA 0C 00 60 00 00 00 00    ......`....`....
011C20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
011C30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
011C40:  CA 0C 00 3F 05 13 CC F0 00 CC 00 A8 B1 00 CC 00    ...?............
011C50:  CC 00 C0 C0 13 CC F1 00 CC F0 00 C0 C0 13 C0 C0    ................
011C60:  13 AA F1 00 CE F0 00 C2 C0 11 CE F0 00 CE 01 C2    ................
011C70:  C0 11 CE F0 00 CE F0 00 AA B1 00 CE 00 CE 00 C2    ................
011C80:  C3 0B 60 C3 93 60 C3 77 60 66 04 06 03 DD 21 DA    ..`..`.w`f....!.
011C90:  63 FD 21 06 63 11 1C 00 C5 DD 36 06 01 DD 72 09    c.!.c.....6...r.
011CA0:  DD 72 1B DD 36 05 10 FD 6E 00 FD 66 01 7E DD 77    .r..6...n..f.~.w
011CB0:  08 23 4E 23 46 23 DD 75 0C DD 74 0D DD 71 00 DD    .#N#F#.u..t..q..
011CC0:  70 01 DD 19 FD 23 FD 23 C1 10 CD 3E 06 32 BB 60    p....#.#...>.2.`
011CD0:  7A 32 CF 60 3C 32 B6 60 3E 38 32 C0 60 3E FF 32    z2.`<2.`>82.`>.2
011CE0:  02 63 32 03 63 32 04 63 32 05 63 3E 0C 4A CD E4    .c2.c2.c2.c>.J..
011CF0:  62 3E 0D 4A C3 E4 62 3E 07 0E 3F CD E4 62 3E 08    b>.J..b>..?..b>.
011D00:  0E 00 CD E4 62 3E 09 0E 00 CD E4 62 3E 0A 0E 00    ....b>.....b>...
011D10:  C3 E4 62 21 B6 60 35 DD 21 DA 63 01 E8 63 CD 49    ..b!.`5.!.c..c.I
011D20:  61 DD 21 F6 63 01 04 64 CD 49 61 DD 21 12 64 01    a.!.c..d.Ia.!.d.
011D30:  20 64 CD 49 61 3E 00 B7 20 05 3E 00 32 B6 60 3E     d.Ia>.. .>.2.`>
011D40:  00 21 03 63 BE 28 07 77 4F 3E 07 CD E4 62 3E 00    .!.c.(.wO>...b>.
011D50:  21 02 63 BE 28 07 77 4F 3E 06 CD E4 62 3E 00 21    !.c.(.wO>...b>.!
011D60:  04 63 BE 28 07 77 4F 3E 0B CD E4 62 3E 00 21 05    .c.(.wO>...b>.!.
011D70:  63 BE C8 77 4F 3E 0D C3 E4 62 23 46 DD 70 06 23    c..wO>...b#F.p.#
011D80:  DD 75 00 DD 74 01 C3 FA 61 23 7E DD 77 06 23 DD    .u..t...a#~.w.#.
011D90:  75 00 DD 74 01 AF DD 77 17 DD 77 15 4F DD 7E 04    u..t...w..w.O.~.
011DA0:  C3 E4 62 DD 36 0A 00 DD 6E 0C DD 66 0D 7E FE 80    ..b.6...n..f.~..
011DB0:  20 06 23 5E 23 56 EB 7E 23 5E 23 56 23 DD 75 0C     .#^#V.~#^#V#.u.
011DC0:  DD 74 0D DD 77 08 EB 18 13 3A B6 60 B7 C2 FA 61    .t..w....:.`...a
011DD0:  DD 35 06 C2 FA 61 DD 6E 00 DD 66 01 7E B7 28 9A    .5...a.n..f.~.(.
011DE0:  FE FE 28 A5 FE FF 28 BB 16 00 E6 7F D6 0A DD 86    ..(...(.........
011DF0:  08 DD 77 07 87 5F E5 21 0C 63 19 7E DD 77 18 23    ..w.._.!.c.~.w.#
011E00:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
011E10:  0F 00 01 00 02 09 4E E5 0F 00 C1 02 00 00 00 02    ......N.........
011E20:  0F 00 C6 02 00 00 00 02 0F 00 C2 02 00 00 00 02    ................
011E30:  0F 00 C7 02 00 00 00 02 0F 00 C3 02 00 00 00 02    ................
011E40:  0F 00 C8 02 00 00 00 02 0F 00 C4 02 00 00 00 02    ................
011E50:  0F 00 C9 02 00 00 00 02 0F 00 C5 02 00 00 00 02    ................
011E60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
011E70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
011E80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
011E90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
011EA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
011EB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
011EC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
011ED0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
011EE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
011EF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
011F00:  C0 19 C9 F0 00 C9 01 BD C0 19 C9 F0 00 C9 00 A5    ................
011F10:  B1 00 C9 00 C9 00 BD C0 19 C9 F1 00 C9 F0 00 BD    ................
011F20:  C0 19 BD 00 A3 F1 00 C7 F0 00 BB C0 1C C7 F0 00    ....£...........
011F30:  C7 01 BB C0 1C C7 F0 00 C7 00 A3 B1 00 C7 00 C7    ..........£.....
011F40:  00 BB C0 1C C7 F1 00 C7 F0 00 BB C0 1C BB C0 1C    ................
011F50:  C0 F1 00 CC F0 00 C0 C0 15 CC F0 00 CC 01 C0 C0    ................
011F60:  15 CC F0 00 CC 00 A8 B1 00 CC 00 CC 00 C0 C0 15    ................
011F70:  CC F1 00 CC F0 00 C0 C0 15 C0 C0 15 AA F1 00 CE    ................
011F80:  F0 00 C2 C0 13 CE F0 00 CE 01 C2 C0 13 CE F0 00    ................
011F90:  CE F0 00 AA B1 00 CE 00 CE 00 C2 C0 13 CE F1 00    ................
011FA0:  CE F0 00 C2 C0 13 C2 C0 13 FF A5 F1 00 C9 F0 00    ................
011FB0:  BD C0 19 C9 F0 00 C9 01 BD C0 19 C9 F0 00 C9 00    ................
011FC0:  A5 B1 00 C9 00 C9 00 BD C0 19 C9 F1 00 C9 F0 00    ................
011FD0:  BD C0 19 BD 00 A3 F1 00 C7 F0 00 BB C0 1C C7 F0    .....£..........
011FE0:  00 C7 01 BB C0 1C C7 F0 00 C7 00 A3 B1 00 C7 00    ...........£....
011FF0:  C7 00 BB C0 1C C7 F1 00 C7 F0 00 BB C0 1C BB C0    ................
012000:  1C C0 F1 00 CC F0 00 C0 C0 15 CC F0 00 CC 01 C0    ................
012010:  C0 15 CC F0 00 CC 00 A8 B1 00 CC 00 CC 00 C0 C0    ................
012020:  15 CC F1 00 CC F0 00 C0 C0 15 C0 C0 15 AA F1 00    ................
012030:  CE F0 00 C2 C0 13 CE F0 00 CE 01 C2 C0 13 CE F0    ................
012040:  00 CE F0 00 AA B1 00 CE 00 CE 00 C2 C0 13 CE F1    ................
012050:  00 CE F0 00 C2 C0 13 C2 C0 13 FF C9 F3 00 49 02    ..............I.
012060:  B3 0F C9 B3 00 49 02 B3 0F C9 B3 00 49 02 B3 0F    .....I......I...
012070:  C9 B3 00 49 02 B3 0F C9 B3 00 49 03 B3 0F C7 B3    ...I......I.....
012080:  00 47 02 B3 0F C7 B3 00 47 02 B3 0F C7 B3 00 47    .G......G......G
012090:  02 B3 0F C7 B3 00 47 02 B3 0F C7 B3 00 47 03 B3    ......G......G..
0120A0:  0F CC B3 00 4C 02 B3 0F CC B3 00 4C 02 B3 0F CC    ....L......L....
0120B0:  B3 00 4C 02 B3 0F CC B3 00 4C 02 B3 0F CC B3 00    ..L......L......
0120C0:  4C 03 B3 0F CE B3 00 4E 02 B3 0F CE B3 00 4E 02    L......N......N.
0120D0:  B3 0F CE B3 00 4E 02 B3 0F CE B3 00 4E 02 B3 0F    .....N......N...
0120E0:  CE B3 00 4E 03 B3 0F FF A5 F1 00 C9 F0 00 BD C0    ...N............
0120F0:  16 C9 F0 00 C9 01 BD C0 16 C9 F0 00 C9 00 A5 B1    ................
012100:  00 2D 47 57 46 52 41 4D 45 42 41 53 00 00 00 00    .-GWFRAMEBAS....
012110:  00 00 00 00 00 70 01 00 BF 01 00 00 00 00 00 00    .....p..........
012120:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
012130:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
012140:  BF 01 00 FD 04 01 2C 0F 01 94 20 1A 50 02 2C 1A    ......,... .P.,.
012150:  2E 01 2C 0F 01 94 20 1A 50 02 2C 1A 90 01 2C 0F    ..,... .P.,...,.
012160:  00 21 00 50 00 CB 20 22 66 72 61 6D 65 2E 73 63    .!.P.. "frame.sc
012170:  72 22 2C 0D 00 00 E2 2C 1C 00 C0 2C 1C 00 40 01    r",....,...,..@.
012180:  30 00 01 00 01 C0 20 47 57 20 63 61 64 72 65 20    0..... GW cadre 
012190:  2A 20 55 74 69 6C 69 74 61 69 72 65 20 47 68 6F    * Utilitaire Gho
0121A0:  75 6C 27 73 20 57 72 69 74 65 72 20 31 2E 30 00    ul's Writer 1.0.
0121B0:  07 00 02 00 01 C0 00 24 00 03 00 01 C0 20 54 6F    .......$..... To
0121C0:  6D 20 65 74 20 4A 65 72 72 79 20 6F 66 20 47 50    m et Jerry of GP
0121D0:  41 20 28 63 29 20 31 39 39 34 00 07 00 04 00 01    A (c) 1994......
0121E0:  C0 00 1F 00 0A 00 83 20 1C 4E BB 01 82 20 0E 01    ....... .N... ..
0121F0:  A2 20 0E 2C 0E 01 A2 20 0F 2C 19 1A 01 AD 20 10    . .,... .,.... .
012200:  00 41 00 14 00 BF 20 22 47 68 6F 75 6C 27 73 20    .A.... "Ghoul's 
012210:  57 72 69 74 65 72 20 46 72 61 6D 65 20 4D 61 6B    Writer Frame Mak
012220:  65 72 20 20 54 6F 6D 20 65 74 20 4A 65 72 72 79    er  Tom et Jerry
012230:  20 6F 66 20 47 50 41 20 28 63 29 20 31 39 39 34     of GPA (c) 1994
012240:  22 00 12 00 1E 00 BF 20 FF 7B 28 19 50 2C 22 5F    "...... .{(.P,"_
012250:  22 29 3B 00 56 00 28 00 BF 01 BF 20 22 53 63 72    ");.V.(.... "Scr
012260:  65 65 6E 20 69 6E 20 6D 6F 64 65 20 28 30 29 20    een in mode (0) 
012270:  6F 72 20 69 6E 20 6D 6F 64 65 20 28 31 29 20 3F    or in mode (1) ?
012280:  22 01 03 00 00 EB EF 22 22 01 D6 20 03 00 00 EB    "......"".. ....
012290:  F2 22 30 22 20 FA 20 03 00 00 EB F2 22 31 22 01    ."0" . ....."1".
0122A0:  03 00 00 EB EF FF 43 01 D5 00 33 00 32 00 BF 01    ......C...3.2...
0122B0:  BF 20 22 50 72 65 73 73 20 61 20 6B 65 79 20 74    . "Press a key t
0122C0:  6F 20 73 61 76 65 20 66 69 6C 65 20 46 52 41 4D    o save file FRAM
0122D0:  45 2E 53 43 52 22 01 83 20 1C 18 BB 00 19 00 3C    E.SCR".. ......<
0122E0:  00 0D 00 00 EB EF FF 1D 28 03 00 00 EB 29 01 AD    ........(....)..
0122F0:  20 0D 00 00 EB 00 26 00 46 00 BC 20 0F 2C 1A 2E     .....&.F.. .,..
012300:  00 C9 00 C9 00 BD C0 16 C9 F1 00 C9 F0 00 BD C0    ................
012310:  16 BD 00 A3 F1 00 C7 F0 00 BB C0 19 C7 F0 00 C7    ...£............
012320:  01 BB C0 19 C7 F0 00 C7 00 A3 B1 00 C7 00 C7 00    .........£......
012330:  BB C0 19 C7 F1 00 C7 F0 00 BB C0 19 BB C0 19 C0    ................
012340:  F1 00 CC F0 00 C0 C0 13 CC F0 00 CC 01 C0 C0 13    ................
012350:  CC F0 00 CC 00 A8 B1 00 CC 00 CC 00 C0 C0 13 CC    ................
012360:  F1 00 CC F0 00 C0 C0 13 C0 C0 13 AA F1 00 CE F0    ................
012370:  00 C2 C0 11 CE F0 00 CE 01 C2 C0 11 CE F0 00 CE    ................
012380:  F0 00 AA B1 00 CE 00 CE 00 C2 C0 11 CE F1 00 CE    ................
012390:  F0 00 C2 C0 11 C2 C0 11 FF A5 F1 00 C9 F0 00 BD    ................
0123A0:  C0 16 C9 F0 00 C9 01 BD C0 16 C9 F0 00 C9 00 A5    ................
0123B0:  B1 00 C9 00 C9 00 BD C0 16 C9 F1 00 C9 F0 00 BD    ................
0123C0:  C0 16 BD 00 A3 F1 00 C7 F0 00 BB C0 19 C7 F0 00    ....£...........
0123D0:  C7 01 BB C0 19 C7 F0 00 C7 00 A3 B1 00 C7 00 C7    ..........£.....
0123E0:  00 BB C0 19 C7 F1 00 C7 F0 00 BB C0 19 BB C0 19    ................
0123F0:  C0 F1 00 CC F0 00 C0 C0 13 CC F0 00 CC 01 C0 C0    ................
012400:  13 CC F0 00 CC 00 A8 B1 00 CC 00 CC 00 C0 C0 13    ................
012410:  CC F1 00 CC F0 00 C0 C0 13 C0 C0 13 AA F1 00 CE    ................
012420:  F0 00 C2 C0 11 CE F0 00 CE 01 C2 C0 11 CE F0 00    ................
012430:  CE F0 00 AA B1 00 CE 00 CE 00 C2 C0 11 CE F1 00    ................
012440:  CE F0 00 C2 C0 11 C2 C0 11 FF 1A 00 00 00 00 00    ................
012450:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
012460:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
012470:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
012480:  00 47 02 B3 0F C7 B3 00 47 02 B3 0F C7 B3 00 47    .G......G......G
012490:  02 B3 0F C7 B3 00 47 02 B3 0F C7 B3 00 47 03 B3    ......G......G..
0124A0:  0F CC B3 00 4C 02 B3 0F CC B3 00 4C 02 B3 0F CC    ....L......L....
0124B0:  B3 00 4C 02 B3 0F CC B3 00 4C 02 B3 0F CC B3 00    ..L......L......
0124C0:  4C 03 B3 0F CE B3 00 4E 02 B3 0F CE B3 00 4E 02    L......N......N.
0124D0:  B3 0F CE B3 00 4E 02 B3 0F CE B3 00 4E 02 B3 0F    .....N......N...
0124E0:  CE B3 00 4E 03 B3 0F FF A5 F1 00 C9 F0 00 BD C0    ...N............
0124F0:  16 C9 F0 00 C9 01 BD C0 16 C9 F0 00 C9 00 A5 B1    ................
012500:  01 2C 0F 01 94 20 1A 50 02 2C 1A 2E 01 2C 0F 01    .,... .P.,...,..
012510:  94 20 1A 50 02 2C 1A 90 01 2C 0F 00 21 00 50 00    . .P.,...,..!.P.
012520:  CB 20 22 66 72 61 6D 65 2E 73 63 72 22 2C 0D 00    . "frame.scr",..
012530:  00 E2 2C 1C 00 C0 2C 1C 00 40 01 BF 00 00 00 1A    ..,...,..@......
012540:  BF 00 00 00 1A 6F 20 73 61 76 65 20 66 69 6C 65    .....o save file
012550:  20 46 52 41 4D 45 2E 53 43 52 22 01 83 20 1C 18     FRAME.SCR".. ..
012560:  BB 00 00 00 1A 00 00 00 00 00 00 00 24 00 03 07    ............$...
012570:  00 AA 00 3F 00 C0 00 10 00 02 00 41 09 2A 52 E5    ...?.......A.*R.
012580:  30 00 01 00 01 C0 20 47 57 20 63 61 64 72 65 20    0..... GW cadre 
012590:  2A 20 55 74 69 6C 69 74 61 69 72 65 20 47 68 6F    * Utilitaire Gho
0125A0:  75 6C 27 73 20 57 72 69 74 65 72 20 31 2E 30 00    ul's Writer 1.0.
0125B0:  07 00 02 00 01 C0 00 24 00 03 00 01 C0 20 54 6F    .......$..... To
0125C0:  6D 20 65 74 20 4A 65 72 72 79 20 6F 66 20 47 50    m et Jerry of GP
0125D0:  41 20 28 63 29 20 31 39 39 34 00 07 00 04 00 01    A (c) 1994......
0125E0:  C0 00 1F 00 0A 00 83 20 1C 4E BB 01 82 20 0E 01    ....... .N... ..
0125F0:  A2 20 0E 2C 0E 01 A2 20 0F 2C 19 1A 01 AD 20 10    . .,... .,.... .
012600:  00 41 00 14 00 BF 20 22 47 68 6F 75 6C 27 73 20    .A.... "Ghoul's 
012610:  57 72 69 74 65 72 20 46 72 61 6D 65 20 4D 61 6B    Writer Frame Mak
012620:  65 72 20 20 54 6F 6D 20 65 74 20 4A 65 72 72 79    er  Tom et Jerry
012630:  20 6F 66 20 47 50 41 20 28 63 29 20 31 39 39 34     of GPA (c) 1994
012640:  22 00 12 00 1E 00 BF 20 FF 7B 28 19 50 2C 22 5F    "...... .{(.P,"_
012650:  22 29 3B 00 56 00 28 00 BF 01 BF 20 22 53 63 72    ");.V.(.... "Scr
012660:  65 65 6E 20 69 6E 20 6D 6F 64 65 20 28 30 29 20    een in mode (0) 
012670:  6F 72 20 69 6E 20 6D 6F 64 65 20 28 31 29 20 3F    or in mode (1) ?
012680:  22 01 03 00 00 EB EF 22 22 01 D6 20 03 00 00 EB    "......"".. ....
012690:  F2 22 30 22 20 FA 20 03 00 00 EB F2 22 31 22 01    ."0" . ....."1".
0126A0:  03 00 00 EB EF FF 43 01 D5 00 33 00 32 00 BF 01    ......C...3.2...
0126B0:  BF 20 22 50 72 65 73 73 20 61 20 6B 65 79 20 74    . "Press a key t
0126C0:  6F 20 73 61 76 65 20 66 69 6C 65 20 46 52 41 4D    o save file FRAM
0126D0:  45 2E 53 43 52 22 01 83 20 1C 18 BB 00 19 00 3C    E.SCR".. ......<
0126E0:  00 0D 00 00 EB EF FF 1D 28 03 00 00 EB 29 01 AD    ........(....)..
0126F0:  20 0D 00 00 EB 00 26 00 46 00 BC 20 0F 2C 1A 2E     .....&.F.. .,..
012700:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
012710:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
012720:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
012730:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
012740:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
012750:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
012760:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
012770:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
012780:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
012790:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0127A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0127B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0127C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0127D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0127E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0127F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
012800:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
012810:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
012820:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
012830:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
012840:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
012850:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
012860:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
012870:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
012880:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
012890:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0128A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0128B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0128C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0128D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0128E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0128F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
012900:  00 41 52 4D 59 20 20 20 20 46 4E 54 00 00 00 00    .ARMY    FNT....
012910:  00 00 02 00 00 00 7D 00 00 03 00 7D 00 00 00 00    ......}....}....
012920:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
012930:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
012940:  00 03 00 A3 03 00 00 41 52 4D 59 20 20 20 20 24    ...£...ARMY    $
012950:  24 24 FF 00 FF 00 00 02 00 00 00 40 00 00 40 00    $$.........@..@.
012960:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
012970:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
012980:  00 00 00 00 00 00 00 00 18 18 18 18 18 00 18 00    ................
012990:  6C 6C 6C 00 00 00 00 00 6C 6C FE 6C FE 6C 6C 00    lll.....ll.l.ll.
0129A0:  18 3E 58 3C 1A 7C 18 00 00 C6 CC 18 30 66 C6 00    .>X<.|......0f..
0129B0:  38 6C 38 76 DC CC 76 00 18 18 30 00 00 00 00 00    8l8v..v...0.....
0129C0:  0C 18 30 30 30 18 0C 00 30 18 0C 0C 0C 18 30 00    ..000...0.....0.
0129D0:  00 66 3C E7 3C 66 00 00 00 18 18 7E 18 18 00 00    .f<.<f.....~....
0129E0:  00 00 00 00 00 18 18 30 00 00 00 7E 00 00 00 00    .......0...~....
0129F0:  00 00 00 00 00 18 18 00 06 0C 18 30 60 C0 80 00    ...........0`...
012A00:  5C C6 CE D6 E6 C6 5C 00 18 30 08 18 18 18 7E 00    \.....\..0....~.
012A10:  2C 66 06 2C 60 66 6E 00 2C 66 06 1C 06 66 2C 00    ,f.,`fn.,f...f,.
012A20:  1C 3C 6C C0 FE 0C 1E 00 6E 62 60 6C 06 66 2C 00    .<l.....nb`l.f,.
012A30:  2C 66 60 6C 66 66 2C 00 7E 60 06 0C 18 18 18 00    ,f`lff,.~`......
012A40:  2C 66 66 2C 66 66 2C 00 2C 66 66 2E 06 66 2C 00    ,ff,ff,.,ff..f,.
012A50:  00 00 18 18 00 18 18 00 00 00 18 18 00 18 18 30    ...............0
012A60:  0C 18 30 60 30 18 0C 00 00 00 7E 00 00 7E 00 00    ..0`0.....~..~..
012A70:  60 30 18 0C 18 30 60 00 2C 66 66 0C 18 00 18 00    `0...0`.,ff.....
012A80:  60 10 68 0C 6C CC 66 00 38 6C C6 C6 DE C6 C6 00    `.h.l.f.8l......
012A90:  DC C6 C6 FC C6 C6 DC 00 5C C6 C0 C0 C0 C6 5C 00    ........\.....\.
012AA0:  D8 CC C6 C6 C6 CC D8 00 DE C2 C0 D8 C0 C2 DE 00    ................
012AB0:  DE C2 C0 D8 C0 C0 C0 00 5C C6 C0 C0 CE C6 5E 00    ........\.....^.
012AC0:  66 66 66 6E 66 66 66 00 7E 00 18 18 18 00 7E 00    fffnfff.~.....~.
012AD0:  1E 0C 0C 0C CC CC 58 00 C6 C6 CC D8 CC C6 C6 00    ......X.........
012AE0:  C0 C0 C0 C0 C0 C6 DE 00 C6 EE EE EE D6 C6 C6 00    ................
012AF0:  C6 C6 D6 DE CE C6 C6 00 5C C6 C6 C6 C6 C6 5C 00    ........\.....\.
012B00:  00 2D 47 57 2D 55 4B 20 20 42 41 53 00 00 00 00    .-GW-UK  BAS....
012B10:  00 00 00 00 00 70 01 00 75 02 00 00 00 00 00 00    .....p..u.......
012B20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
012B30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
012B40:  75 02 00 0D 04 6F 67 72 61 6D 22 01 A9 20 19 12    u....ogram".. ..
012B50:  2C 19 0F 01 BF 20 22 3C 51 3E 20 2E 2E 2E 2E 2E    ,.... "<Q> .....
012B60:  2E 2E 2E 2E 2E 2E 2E 2E 2E 20 3E 20 51 75 69 74    ......... > Quit
012B70:  22 00 46 00 82 00 03 00 00 EB EF 22 22 01 D6 20    ".F........"".. 
012B80:  39 00 0A 00 01 C0 20 4D 75 6C 74 69 20 4D 61 72    9..... Multi Mar
012B90:  6B 20 31 2E 30 20 75 73 65 72 27 73 20 6D 61 6E    k 1.0 user's man
012BA0:  75 65 6C 20 72 65 61 64 65 72 20 28 63 29 20 54    uel reader (c) T
012BB0:  26 4A 20 31 39 39 34 20 00 07 00 14 00 01 C0 00    &J 1994 ........
012BC0:  25 00 1E 00 01 C0 20 53 68 69 74 74 79 20 70 72    %..... Shitty pr
012BD0:  6F 67 72 61 6D 2C 20 6E 6F 20 61 73 6D 20 63 6F    ogram, no asm co
012BE0:  64 65 20 21 00 07 00 28 00 01 C0 00 1F 00 32 00    de !...(......2.
012BF0:  83 20 1C 4E BB 01 82 20 0E 01 A2 20 0E 2C 0E 01    . .N... ... .,..
012C00:  A2 20 0F 2C 19 12 01 AD 20 10 00 75 00 3C 00 BF    . .,.... ..u.<..
012C10:  20 22 50 72 69 6E 74 20 75 73 65 72 27 73 20 6D     "Print user's m
012C20:  61 6E 75 61 6C 20 28 59 20 2F 20 4E 29 22 01 03    anual (Y / N)"..
012C30:  00 00 EB EF 22 22 01 D6 20 03 00 00 EB F2 22 59    ...."".. ....."Y
012C40:  22 20 FA 20 03 00 00 EB F2 22 4E 22 01 03 00 00    " . ....."N"....
012C50:  EB EF FF 1C 28 FF 43 29 01 D5 01 0D 00 00 63 61    ....(.C)......ca
012C60:  6E 61 EC EF 0E 01 A1 20 03 00 00 EB EF 22 59 22    na..... ....."Y"
012C70:  20 EB 20 0D 00 00 63 61 6E 61 EC 20 EF 20 16 00     . ...cana. . ..
012C80:  24 00 46 00 A1 20 0D 00 00 63 61 6E 61 EC EF 16    $.F.. ...cana...
012C90:  20 EB 20 BF 20 22 50 72 69 6E 74 69 6E 67 2E 2E     . . "Printing..
012CA0:  2E 2E 22 00 16 00 50 00 AD 20 10 01 B6 20 22 47    .."...P.. ... "G
012CB0:  57 2D 55 4B 2E 44 4F 43 22 00 1E 00 5A 00 0D 00    W-UK.DOC"...Z...
012CC0:  00 E1 EF 0F 01 D6 20 FE 20 FF 40 01 A6 20 A3 20    ...... . .@.. £ 
012CD0:  23 17 2C 03 00 00 E2 00 21 00 64 00 A1 20 FF 40    #.,.....!.d.. .@
012CE0:  20 EF 20 0E 20 EB 20 BF 20 23 0D 00 00 63 61 6E     . . . . #...can
012CF0:  61 EC 2C 20 03 00 00 E2 00 4B 00 6E 00 A1 20 0D    a., .....K.n.. .
012D00:  DC C6 C6 DC C0 C0 C0 00 5C C6 C6 C6 DA CC 56 00    ........\.....V.
012D10:  DC C6 C6 DC CC C6 C6 00 5C C6 C0 5C 06 C6 5C 00    ........\..\..\.
012D20:  7E 42 18 18 18 18 3C 00 C6 C6 C6 C6 C6 C6 5C 00    ~B....<.......\.
012D30:  C6 C6 C6 C6 C6 5C 18 00 C6 C6 C6 C6 EE EE C6 00    .....\..........
012D40:  C6 6C 18 18 4C E6 C6 00 C6 C6 C6 5C 18 18 3C 00    .l..L......\..<.
012D50:  FE C0 0C 18 30 06 FE 00 3C 30 30 30 30 30 3C 00    ....0...<00000<.
012D60:  00 00 2C 66 60 2E 08 18 3C 0C 0C 0C 0C 0C 3C 00    ..,f`...<.....<.
012D70:  18 24 00 00 00 00 00 00 00 00 00 00 00 00 00 FF    .$..............
012D80:  30 18 0C 00 00 00 00 00 00 00 68 0C 6C CC 66 00    0.........h.l.f.
012D90:  60 60 6C 66 66 66 6C 00 00 00 2C 66 60 66 2C 00    ``lfffl...,f`f,.
012DA0:  0C 0C 6C CC CC CC 6C 00 00 00 2C 66 6E 60 2C 00    ..l...l...,fn`,.
012DB0:  14 36 30 78 30 30 30 00 00 00 2E 66 66 2E 06 6C    .60x000....ff..l
012DC0:  60 60 6C 66 66 66 66 00 18 00 38 00 18 18 3C 00    ``lffff...8...<.
012DD0:  06 00 0E 06 06 66 66 2C E0 60 66 6C 68 6C E6 00    .....ff,.`flhl..
012DE0:  18 18 18 18 18 18 18 00 00 00 4C DE D6 D6 C6 00    ..........L.....
012DF0:  00 00 6C 66 66 66 66 00 00 00 2C 66 66 66 2C 00    ..lffff...,fff,.
012E00:  00 00 6C 66 66 6C 60 F0 00 00 6C CC CC 6C 0C 1E    ..lffl`...l..l..
012E10:  00 00 DC 76 60 00 F0 00 00 00 2E 60 2C 06 6C 00    ...v`......`,.l.
012E20:  30 30 7C 00 30 36 1C 00 00 00 66 66 66 66 36 00    00|.06....ffff6.
012E30:  00 00 66 66 00 3C 18 00 00 00 C6 D6 D6 DE 4C 00    ..ff.<........L.
012E40:  00 00 C6 6C 28 6C C6 00 00 00 66 66 66 2E 06 6C    ...l(l....fff..l
012E50:  00 00 7E 40 18 32 7E 00 06 08 2C 66 6E 60 2C 00    ..~@.2~...,fn`,.
012E60:  30 08 66 66 66 66 36 00 60 10 2C 66 6E 60 2C 00    0.ffff6.`.,fn`,.
012E70:  76 DC 00 00 00 00 00 00 3C 66 60 F8 60 66 FE 00    v.......<f`.`f..
012E80:  60 10 68 0C 6C CC 66 00 38 6C C6 C6 DE C6 C6 00    `.h.l.f.8l......
012E90:  DC C6 C6 FC C6 C6 DC 00 5C C6 C0 C0 C0 C6 5C 00    ........\.....\.
012EA0:  D8 CC C6 C6 C6 CC D8 00 DE C2 C0 D8 C0 C2 DE 00    ................
012EB0:  DE C2 C0 D8 C0 C0 C0 00 5C C6 C0 C0 CE C6 5E 00    ........\.....^.
012EC0:  66 66 66 6E 66 66 66 00 7E 00 18 18 18 00 7E 00    fffnfff.~.....~.
012ED0:  1E 0C 0C 0C CC CC 58 00 C6 C6 CC D8 CC C6 C6 00    ......X.........
012EE0:  C0 C0 C0 C0 C0 C6 DE 00 C6 EE EE EE D6 C6 C6 00    ................
012EF0:  C6 C6 D6 DE CE C6 C6 00 5C C6 C6 C6 C6 C6 5C 00    ........\.....\.
012F00:  00 00 63 61 6E 61 EC 20 EF 20 0E 20 EB 20 0D 00    ..cana. . . . ..
012F10:  00 E1 EF 0D 00 00 E1 F4 0F 01 A1 20 0D 00 00 E1    ........... ....
012F20:  EF 19 19 20 EB 20 0D 00 00 E1 EF 0F 01 CC 20 0F    ... . ........ .
012F30:  2C 19 28 2C 16 2C 19 0F 01 83 20 1C 18 BB 01 AD    ,.(,.,.... .....
012F40:  20 10 20 00 69 00 78 00 D5 01 88 01 83 20 1C 18     . .i.x...... ..
012F50:  BB 01 AD 20 10 01 A9 20 19 12 2C 19 0C 01 BF 20    ... ... ..,.... 
012F60:  22 3C 52 3E 20 2E 2E 2E 2E 2E 2E 2E 2E 2E 2E 2E    "<R> ...........
012F70:  2E 2E 2E 20 3E 20 52 65 73 74 61 72 74 20 70 72    ... > Restart pr
012F80:  6F 67 72 61 6D 22 01 A9 20 19 12 2C 19 0F 01 BF    ogram".. ..,....
012F90:  20 22 3C 51 3E 20 2E 2E 2E 2E 2E 2E 2E 2E 2E 2E     "<Q> ..........
012FA0:  2E 2E 2E 2E 20 3E 20 51 75 69 74 22 00 46 00 82    .... > Quit".F..
012FB0:  00 03 00 00 EB EF 22 22 01 D6 20 03 00 00 EB F2    ......"".. .....
012FC0:  22 72 22 20 FA 20 03 00 00 EB F2 22 71 22 01 03    "r" . ....."q"..
012FD0:  00 00 EB EF FF 11 28 FF 43 29 01 D5 01 A1 20 03    ......(.C).... .
012FE0:  00 00 EB EF 22 71 22 20 EB 20 83 20 0E 01 01 97    ...."q" . . ....
012FF0:  20 CA 00 00 00 1A 77 61 72 65 20 21 0D 0A 0D 0A     .....ware !....
013000:  A2 20 0F 2C 19 12 01 AD 20 10 00 75 00 3C 00 BF    . .,.... ..u.<..
013010:  20 22 50 72 69 6E 74 20 75 73 65 72 27 73 20 6D     "Print user's m
013020:  61 6E 75 61 6C 20 28 59 20 2F 20 4E 29 22 01 03    anual (Y / N)"..
013030:  00 00 EB EF 22 22 01 D6 20 03 00 00 EB F2 22 59    ...."".. ....."Y
013040:  22 20 FA 20 03 00 00 EB F2 22 4E 22 01 03 00 00    " . ....."N"....
013050:  EB EF FF 1C 28 FF 43 29 01 D5 01 0D 00 00 63 61    ....(.C)......ca
013060:  6E 61 EC EF 0E 01 A1 20 03 00 00 EB EF 22 59 22    na..... ....."Y"
013070:  20 EB 20 0D 00 00 63 61 6E 61 EC 20 EF 20 16 00     . ...cana. . ..
013080:  24 00 46 00 A1 20 0D 00 00 63 61 6E 61 EC EF 16    $.F.. ...cana...
013090:  20 EB 20 BF 20 22 50 72 69 6E 74 69 6E 67 2E 2E     . . "Printing..
0130A0:  2E 2E 22 00 16 00 50 00 AD 20 10 01 B6 20 22 47    .."...P.. ... "G
0130B0:  57 2D 55 4B 2E 44 4F 43 22 00 1E 00 5A 00 0D 00    W-UK.DOC"...Z...
0130C0:  00 E1 EF 0F 01 D6 20 FE 20 FF 40 01 A6 20 A3 20    ...... . .@.. £ 
0130D0:  23 17 2C 03 00 00 E2 00 21 00 64 00 A1 20 FF 40    #.,.....!.d.. .@
0130E0:  20 EF 20 0E 20 EB 20 BF 20 23 0D 00 00 63 61 6E     . . . . #...can
0130F0:  61 EC 2C 20 03 00 00 E2 00 4B 00 6E 00 A1 20 0D    a., .....K.n.. .
013100:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
013110:  10 00 01 00 02 09 4E E5 10 00 C1 02 00 00 00 02    ......N.........
013120:  10 00 C6 02 00 00 00 02 10 00 C2 02 00 00 00 02    ................
013130:  10 00 C7 02 00 00 00 02 10 00 C3 02 00 00 00 02    ................
013140:  10 00 C8 02 00 00 00 02 10 00 C4 02 00 00 00 02    ................
013150:  10 00 C9 02 00 00 00 02 10 00 C5 02 00 00 00 02    ................
013160:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
013170:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
013180:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
013190:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0131A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0131B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0131C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0131D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0131E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0131F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
013200:  00 43 48 41 4D 50 41 47 4E 47 57 58 00 00 00 00    .CHAMPAGNGWX....
013210:  00 00 02 00 00 00 96 00 00 01 00 96 00 00 00 00    ................
013220:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
013230:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
013240:  00 01 00 65 04 00 00 43 48 41 4D 50 41 47 4E 24    ...e...CHAMPAGN$
013250:  24 24 FF 00 FF 77 00 18 16 3D 3D DD 77 00 01 00    $$...w...==.w...
013260:  F0 09 7C D6 C0 30 04 01 B6 3F 09 3E 08 86 77 DD    ..|..0...?.>..w.
013270:  23 DD 23 08 3D 20 C0 C9 0C 06 78 2D 2C 20 56 43    #.#.= ....x-, VC
013280:  C3 07 96 C3 23 96 C9 21 00 97 11 06 C2 3E 90 73    ....#..!.....>.s
013290:  23 72 23 EB 01 00 08 09 30 04 01 4A C0 09 EB 3D    #r#.....0..J...=
0132A0:  20 ED C9 3E 10 DD 21 B3 96 16 00 08 01 00 97 DD     ..>..!.........
0132B0:  6E 00 5D 62 29 09 4E 23 46 DD 6E 01 62 09 7E E6    n.]b).N#F.n.b.~.
0132C0:  F0 77 7B A7 20 07 3E 8E DD 77 00 18 15 3D DD 77    .w{. .>..w...=.w
0132D0:  00 01 00 F8 09 7C D6 C0 30 04 01 B6 3F 09 3E 04    .....|..0...?.>.
0132E0:  86 77 DD 23 DD 23 08 3D 20 C1 3E 0A DD 21 D3 96    .w.#.#.= .>..!..
0132F0:  16 00 08 01 00 97 DD 6E 00 62 5D 29 09 4E 23 46    .......n.b]).N#F
013300:  DD 6E 01 62 09 7E E6 F0 77 7B A7 20 07 3E 8E DD    .n.b.~..w{. .>..
013310:  77 00 18 16 3D 3D DD 77 00 01 00 F0 09 7C D6 C0    w...==.w.....|..
013320:  30 04 01 B6 3F 09 3E 08 86 77 DD 23 DD 23 08 3D    0...?.>..w.#.#.=
013330:  20 C0 C9 0C 06 78 2D 2C 20 56 43 1E 38 8C 1C 18     ....x-, VC.8...
013340:  33 48 03 32 10 64 1A 84 0B 42 2F 06 24 5E 3A 28    3H.2.d...B/.$^:(
013350:  16 36 46 64 01 7A 08 2C 13 4E 17 02 45 26 35 5E    .6Fd.z.,.N..E&5^
013360:  3F 88 26 34 49 68 31 00 00 00 00 00 00 00 00 00    ?.&4Ih1.........
013370:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
013380:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
013390:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0133A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0133B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0133C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0133D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0133E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0133F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
013400:  00 00 01 00 01 00 01 00 01 00 00 00 00 00 00 00    ................
013410:  00 00 01 00 01 00 01 00 01 00 00 00 00 00 00 00    ................
013420:  00 00 0D 0E 0D 0C 80 80 80 80 80 80 80 80 80 80    ................
013430:  80 80 80 80 80 80 80 80 80 80 80 80 80 80 80 80    ................
013440:  80 80 80 00 00 01 80 01 00 02 80 02 00 03 00 04    ................
013450:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
013460:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
013470:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
013480:  00 00 0F 0F 0E 0E 0D 0C 00 00 00 00 00 00 00 00    ................
013490:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0134A0:  00 00 06 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0134B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0134C0:  00 00 0F 0D 0B 09 07 05 04 06 08 06 04 02 00 00    ................
0134D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0134E0:  00 00 07 0B 0F 13 17 1B 1F 13 08 03 00 00 00 00    ................
0134F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
013500:  00 00 0E 0D 0D 0C 0C 0B 0B 0B 0A 09 09 09 09 09    ................
013510:  09 09 09 09 09 09 09 09 08 07 06 05 04 03 02 01    ................
013520:  01 01 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
013530:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
013540:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
013550:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
013560:  00 00 FF FE FD FC FB FA F9 F8 F7 F6 F5 F4 F3 F2    ................
013570:  F1 F0 EF EE ED EC EB EA E9 E8 E7 E6 E5 E4 E3 E2    ................
013580:  E1 E0 00 BF 67 00 EF 67 00 1D 68 00 1D 68 00 BF    ....g..g..h..h..
013590:  67 00 EF 67 00 1D 68 00 3B 68 00 55 68 00 75 68    g..g..h.;h.Uh.uh
0135A0:  00 75 68 00 9F 68 00 E2 68 00 9F 68 00 9F 68 00    .uh..h..h..h..h.
0135B0:  25 69 00 47 69 00 B8 69 00 75 69 00 BB 69 80 02    %i.Gi..i.ui..i..
0135C0:  67 00 06 6A 00 96 6A 00 26 6B 00 26 6B 00 06 6A    g..j..j.&k.&k..j
0135D0:  00 96 6A 00 26 6B 00 B6 6B 00 B6 6B 00 B6 6B 00    ..j.&k..k..k..k.
0135E0:  B6 6B 00 B6 6B 00 46 6C 00 8C 6C 00 B6 6B 00 D2    .k..k.Fl..l..k..
0135F0:  6C 00 D2 6C 00 D2 6C 00 D2 6C 00 62 6D 80 41 67    l..l..l..l.bm.Ag
013600:  23 C1 10 ED C9 21 DF 02 7E 32 25 90 23 7E 32 22    #....!..~2%.#~2"
013610:  90 23 7E 32 23 90 21 E2 02 06 08 11 1A 90 CD AE    .#~2#.!.........
013620:  05 21 EA 02 06 01 11 17 90 CD AE 05 21 EB 02 06    .!..........!...
013630:  01 11 03 90 CD AE 05 21 EC 02 06 01 11 04 90 CD    .......!........
013640:  AE 05 3A EE 02 32 05 90 21 EF 02 06 10 11 06 90    ..:..2..!.......
013650:  CD AE 05 3A ED 02 32 24 90 3A F3 11 32 18 90 A7    ...:..2$.:..2...
013660:  C0 3E C9 32 00 96 32 03 96 C9 CD 4A 05 CD 37 06    .>.2..2....J..7.
013670:  A7 CA 4A 06 C3 57 06 21 28 08 06 05 3A F3 11 A7    ..J..W.!(...:...
013680:  28 01 04 7E A7 C8 23 10 FA C9 21 6A 05 CD 06 08    (..~..#...!j....
013690:  CD 18 BB CD 03 08 C9 CD C5 05 21 7C 05 CD 06 08    ..........!|....
0136A0:  CD 18 BB 3E 02 CD 0E BC CD 00 90 3E 02 CD 0E BC    ...>.......>....
0136B0:  C9 E5 21 52 00 01 0E 00 3D A7 28 04 09 3D 20 FC    ..!R....=.(..= .
0136C0:  E5 D1 E5 13 01 0B 00 36 20 ED B0 D1 E1 23 23 01    .......6 ....##.
0136D0:  08 00 ED B0 C9 00 00 00 00 00 00 00 00 00 00 00    ................
0136E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0136F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
013700:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
013710:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
013720:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
013730:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
013740:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
013750:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
013760:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
013770:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
013780:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
013790:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0137A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0137B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0137C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0137D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0137E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0137F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
013800:  00 F2 6D 00 36 6E 00 78 6E 00 78 6E 00 F2 6D 00    ..m.6n.xn.xn..m.
013810:  36 6E 00 78 6E 00 BA 6E 00 19 6F 00 88 6F 00 88    6n.xn..n..o..o..
013820:  6F 00 F7 6F 00 55 70 00 9A 70 00 F7 6F 00 E9 70    o..o.Up..p..o..p
013830:  00 E9 70 00 E9 70 00 E9 70 00 2B 71 80 80 67 3A    ..p..p..p.+q..g:
013840:  04 F1 00 46 02 01 44 84 41 84 3D 82 3F 82 41 84    ...F..D.A.=.?.A.
013850:  3A 88 3D 82 3F 82 41 84 3D 82 3F 82 41 84 3D 82    :.=.?.A.=.?.A.=.
013860:  3F 82 41 84 44 84 41 82 BF 01 C1 01 3F 82 FF 3A    ?.A.D.A.....?..:
013870:  04 01 46 82 44 84 41 84 3D 82 3F 82 41 84 3A 88    ..F.D.A.=.?.A.:.
013880:  3D 82 3F 82 41 84 3D 82 3F 82 41 84 3D 82 3F 82    =.?.A.=.?.A.=.?.
013890:  41 84 44 84 41 82 3F 82 C6 01 C8 01 FF 49 04 01    A.D.A.?......I..
0138A0:  48 82 46 84 44 84 41 92 3F 86 41 82 42 82 41 82    H.F.D.A.?.A.B.A.
0138B0:  3F 82 41 86 3F 82 3D 84 3F 86 FF 42 04 01 41 82    ?.A.?.=.?..B..A.
0138C0:  3F 84 3D 84 3A 8F BD 01 3F 82 42 84 41 82 3F 84    ?.=.:...?.B.A.?.
0138D0:  3D 84 3F 92 FF 42 04 01 41 82 3F 84 3D 84 3A 8F    =.?..B..A.?.=.:.
0138E0:  BD 01 3F 82 42 84 41 82 3F 84 3D 84 44 8D 46 82    ..?.B.A.?.=.D.F.
0138F0:  C6 01 49 82 FF 46 02 F1 00 49 02 01 4D 82 49 82    ..I..F...I..M.I.
013900:  4D 82 50 82 CD 01 50 83 52 10 01 46 02 01 49 82    M.P...P.R..F..I.
013910:  4D 82 C9 01 4D 83 50 82 4D 82 50 82 52 90 FF 46    M...M.P.M.P.R..F
013920:  02 01 4D 82 4B 82 46 82 4D 82 46 82 CD 00 4E 03    ..M.K.F.M.F...N.
013930:  01 50 82 4E 82 4D 82 49 82 4B 82 4D 82 CB 01 49    .P.N.M.I.K.M...I
013940:  83 4D 82 44 82 4B 82 44 82 49 82 44 82 C8 01 49    .M.D.K.D.I.D...I
013950:  83 4B 82 44 82 49 82 44 82 48 82 44 82 49 82 4B    .K.D.I.D.H.D.I.K
013960:  82 FF 46 02 01 4D 82 4B 82 46 82 4D 82 46 82 CD    ..F..M.K.F.M.F..
013970:  00 4E 03 01 50 82 4E 82 4D 82 49 82 4B 82 4D 82    .N..P.N.M.I.K.M.
013980:  CB 01 49 83 4D 82 44 82 4B 82 44 82 49 82 44 82    ..I.M.D.K.D.I.D.
013990:  C8 01 49 83 4B 82 44 82 49 82 44 82 48 82 44 82    ..I.K.D.I.D.H.D.
0139A0:  49 82 4B 82 FF 52 04 01 54 82 55 86 54 82 55 86    I.K..R..T.U.T.U.
0139B0:  54 82 55 84 57 86 55 84 54 82 55 84 54 84 54 84    T.U.W.U.T.U.T.T.
0139C0:  52 84 54 84 52 86 FF 52 04 B1 00 54 02 01 55 86    R.T.R..R...T..U.
0139D0:  57 82 59 88 5C 82 59 82 57 82 D5 01 57 83 59 04    W.Y.\.Y.W...W.Y.
0139E0:  F1 03 4D 84 41 04 01 35 84 29 84 1D 84 91 F1 00    ..M.A..5.)......
0139F0:  11 07 F0 00 FF 3A 04 F1 00 46 02 01 44 84 41 84    .....:...F..D.A.
013A00:  00 44 45 50 45 43 48 45 20 4D 55 53 00 00 00 00    .DEPECHE MUS....
013A10:  00 00 02 00 00 00 60 00 6D 11 00 60 00 00 00 00    ......`.m..`....
013A20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
013A30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
013A40:  6D 11 00 C1 04 2C 82 31 82 2C 82 33 82 2C 82 31    m....,.1.,.3.,.1
013A50:  82 29 82 30 82 29 82 31 82 29 82 30 82 29 82 30    .).0.).1.).0.).0
013A60:  82 2A 82 2E 82 2A 82 30 82 2A 82 2E 82 2A 82 FF    .*...*.0.*...*..
013A70:  22 02 00 2E 82 22 82 2E 82 22 82 2E 82 22 82 2E    "...."..."..."..
013A80:  C3 0B 60 C3 93 60 C3 77 60 66 04 06 03 DD 21 DA    ..`..`.w`f....!.
013A90:  63 FD 21 06 63 11 1C 00 C5 DD 36 06 01 DD 72 09    c.!.c.....6...r.
013AA0:  DD 72 1B DD 36 05 10 FD 6E 00 FD 66 01 7E DD 77    .r..6...n..f.~.w
013AB0:  08 23 4E 23 46 23 DD 75 0C DD 74 0D DD 71 00 DD    .#N#F#.u..t..q..
013AC0:  70 01 DD 19 FD 23 FD 23 C1 10 CD 3E 06 32 BB 60    p....#.#...>.2.`
013AD0:  7A 32 CF 60 3C 32 B6 60 3E 38 32 C0 60 3E FF 32    z2.`<2.`>82.`>.2
013AE0:  02 63 32 03 63 32 04 63 32 05 63 3E 0C 4A CD E4    .c2.c2.c2.c>.J..
013AF0:  62 3E 0D 4A C3 E4 62 3E 07 0E 3F CD E4 62 3E 08    b>.J..b>..?..b>.
013B00:  0E 00 CD E4 62 3E 09 0E 00 CD E4 62 3E 0A 0E 00    ....b>.....b>...
013B10:  C3 E4 62 21 B6 60 35 DD 21 DA 63 01 E8 63 CD 49    ..b!.`5.!.c..c.I
013B20:  61 DD 21 F6 63 01 04 64 CD 49 61 DD 21 12 64 01    a.!.c..d.Ia.!.d.
013B30:  20 64 CD 49 61 3E 00 B7 20 05 3E 00 32 B6 60 3E     d.Ia>.. .>.2.`>
013B40:  00 21 03 63 BE 28 07 77 4F 3E 07 CD E4 62 3E 00    .!.c.(.wO>...b>.
013B50:  21 02 63 BE 28 07 77 4F 3E 06 CD E4 62 3E 00 21    !.c.(.wO>...b>.!
013B60:  04 63 BE 28 07 77 4F 3E 0B CD E4 62 3E 00 21 05    .c.(.wO>...b>.!.
013B70:  63 BE C8 77 4F 3E 0D C3 E4 62 23 46 DD 70 06 23    c..wO>...b#F.p.#
013B80:  DD 75 00 DD 74 01 C3 FA 61 23 7E DD 77 06 23 DD    .u..t...a#~.w.#.
013B90:  75 00 DD 74 01 AF DD 77 17 DD 77 15 4F DD 7E 04    u..t...w..w.O.~.
013BA0:  C3 E4 62 DD 36 0A 00 DD 6E 0C DD 66 0D 7E FE 80    ..b.6...n..f.~..
013BB0:  20 06 23 5E 23 56 EB 7E 23 5E 23 56 23 DD 75 0C     .#^#V.~#^#V#.u.
013BC0:  DD 74 0D DD 77 08 EB 18 13 3A B6 60 B7 C2 FA 61    .t..w....:.`...a
013BD0:  DD 35 06 C2 FA 61 DD 6E 00 DD 66 01 7E B7 28 9A    .5...a.n..f.~.(.
013BE0:  FE FE 28 A5 FE FF 28 BB 16 00 E6 7F D6 0A DD 86    ..(...(.........
013BF0:  08 DD 77 07 87 5F E5 21 0C 63 19 7E DD 77 18 23    ..w.._.!.c.~.w.#
013C00:  3D 82 3F 82 41 84 44 82 BF F0 01 41 82 BF F0 01    =.?.A.D....A....
013C10:  41 82 3D 02 F1 00 3F 02 01 41 84 44 84 41 84 3F    A.=...?..A.D.A.?
013C20:  82 3F 82 41 84 44 82 BF F0 01 41 82 BF F0 01 44    .?.A.D....A....D
013C30:  82 C1 F0 01 C6 F0 01 FF 00 40 FF 3A 04 F1 00 46    .........@.:...F
013C40:  02 01 44 84 41 84 3D 82 3F 82 41 84 44 82 BF F0    ..D.A.=.?.A.D...
013C50:  01 41 02 F1 01 BF F0 01 41 02 F1 01 3D 02 F1 00    .A......A...=...
013C60:  3F 02 01 41 84 44 84 41 84 3F 82 3F 82 41 84 44    ?..A.D.A.?.?.A.D
013C70:  82 BF F0 01 41 02 F1 01 BF F0 01 44 02 F1 01 C1    ....A......D....
013C80:  F0 01 C6 F0 01 FF AE 02 A2 00 DE B4 01 A2 00 B7    ................
013C90:  02 A2 00 DE B4 01 A2 00 AE 02 A2 00 DE B4 01 A2    ................
013CA0:  00 B7 02 A2 00 DE B4 01 A2 00 AE 02 AA 00 DA B4    ................
013CB0:  01 AA 00 B7 02 AA 00 DA B4 01 AA 00 AE 02 AA 00    ................
013CC0:  DA B4 01 AA 00 B7 02 AA 00 DA B4 01 AA 00 AE 02    ................
013CD0:  A7 00 D7 B4 01 A7 00 B7 02 A7 00 D7 B4 01 A7 00    ................
013CE0:  AE 02 A7 00 D7 B4 01 A7 00 B7 02 A7 00 D7 B4 01    ................
013CF0:  A7 00 AE 02 A5 00 D5 B4 01 A5 00 B7 02 A5 00 D5    ................
013D00:  B4 01 A5 00 AE 02 A4 00 D9 B4 01 A4 00 B7 02 A4    ................
013D10:  00 AE 02 AE 02 FF AE 02 A2 00 DE B4 01 A2 00 B7    ................
013D20:  02 A2 00 DE B4 01 A2 00 AE 02 A2 00 DE B4 01 A2    ................
013D30:  00 B7 02 A2 00 DE B4 01 A2 00 AE 02 AA 00 DA B4    ................
013D40:  01 AA 00 B7 02 AA 00 DA B4 01 AA 00 AE 02 AA 00    ................
013D50:  DA B4 01 AA 00 B7 02 AA 00 DA B4 01 AA 00 AE 02    ................
013D60:  A7 00 D7 B4 01 A7 00 B7 02 A7 00 D7 B4 01 A7 00    ................
013D70:  AE 02 A7 00 D7 B4 01 A7 00 B7 02 A7 00 D7 B4 01    ................
013D80:  A7 00 AE 02 AC 00 D5 B4 01 AC 00 B7 02 AC 00 D5    ................
013D90:  B4 01 AC 00 AE 02 AC 00 D9 B4 01 AC 00 B7 02 AC    ................
013DA0:  00 AE 02 AE 02 FF AE 02 AA 00 DE B4 01 AA 00 B7    ................
013DB0:  02 AA 00 DE B4 01 AA 00 AE 02 AA 00 DE B4 01 AA    ................
013DC0:  00 B7 02 AA 00 DE B4 01 AA 00 AE 02 A5 00 DC B4    ................
013DD0:  01 A5 00 B7 02 A5 00 DC B4 01 A5 00 AE 02 A5 00    ................
013DE0:  DC B4 01 A5 00 B7 02 A5 00 DC B4 01 A5 00 AE 02    ................
013DF0:  AC 00 D7 B4 01 AC 00 B7 02 AC 00 D7 B4 01 AC 00    ................
013E00:  7E DD 77 19 E1 3E 01 CB 7E 20 0D 23 7E CB 7F 28    ~.w..>..~ .#~..(
013E10:  07 E6 7F DD 77 06 18 53 DD 77 06 23 E5 7E F5 E6    ....w..S.w.#.~..
013E20:  0F DD BE 05 28 06 DD 77 05 DD 72 0A 87 87 87 5F    ....(..w..r...._
013E30:  21 42 64 19 50 59 ED A0 ED A0 ED A0 ED A0 ED A0    !Bd.PY..........
013E40:  ED A0 ED A0 ED A0 F1 E1 E6 F0 28 1F FE F0 CA A0    ..........(.....
013E50:  62 FE D0 CA BC 62 FE B0 CA C4 62 FE 80 D2 CC 62    b....b....b....b
013E60:  FE 10 20 07 AF DD 77 1B DD 77 09 23 DD 75 00 DD    .. ...w..w.#.u..
013E70:  74 01 DD 36 16 00 DD 36 17 20 DD 7E 17 B7 20 0E    t..6...6. .~.. .
013E80:  DD 7E 15 B7 C8 DD 77 17 DD 7E 14 DD 77 16 16 00    .~....w..~..w...
013E90:  DD 5E 16 DD 34 16 DD 35 17 DD 7E 1B B7 28 1A 67    .^..4..5..~..(.g
013EA0:  DD 6E 1A 19 7E DD 46 07 80 87 42 4F 21 0C 63 09    .n..~.F...BO!.c.
013EB0:  7E DD 77 18 23 7E DD 77 19 DD 66 0F DD 6E 0E 19    ~.w.#~.w..f..n..
013EC0:  19 4E 23 46 DD 6E 18 DD 66 19 09 4D DD 7E 02 CD    .N#F.n..f..M.~..
013ED0:  E4 62 4C DD 7E 03 CD E4 62 DD 66 11 DD 6E 10 19    .bL.~...b.f..n..
013EE0:  7E CB 7F 20 12 E6 0F DD 96 0A 30 01 AF DD B6 09    ~.. ......0.....
013EF0:  4F DD 7E 04 CD E4 62 DD 6E 12 DD 66 13 19 7E CB    O.~...b.n..f..~.
013F00:  7F C0 E6 1F DD 46 0B 4F B7 78 28 08 47 79 32 CF    .....F.O.x(.Gy2.
013F10:  60 78 D6 40 32 9B 62 3A C0 60 CB 47 32 C0 60 C9    `x.@2.b:.`.G2.`.
013F20:  23 7E E5 87 06 00 4F 21 C2 64 09 5E 23 56 DD 73    #~....O!.d.^#V.s
013F30:  1A DD 72 1B DD 36 09 00 E1 C3 EB 61 23 7E 32 BB    ..r..6.....a#~2.
013F40:  60 C3 EB 61 23 7E DD 77 0A C3 EB 61 DD 36 09 10    `..a#~.w...a.6..
013F50:  DD 36 1B 00 7E 0F 0F 0F 0F 32 ED 60 23 7E 32 DE    .6..~....2.`#~2.
013F60:  60 C3 EB 61 06 F4 ED 79 06 F6 ED 78 F6 C0 ED 79    `..a...y...x...y
013F70:  E6 3F ED 79 06 F4 ED 49 06 F6 4F F6 80 ED 79 ED    .?.y...I..O...y.
013F80:  49 C9 FF FF FF FF 02 67 41 67 80 67 EE 0E 18 0E    I......gAg.g....
013F90:  4D 0D 8E 0C DA 0B 2F 0B 8F 0A F7 09 68 09 E1 08    M...../.....h...
013FA0:  61 08 E9 07 77 07 0C 07 A7 06 47 06 ED 05 98 05    a...w.....G.....
013FB0:  47 05 FC 04 B4 04 70 04 31 04 F4 03 BC 03 86 03    G.....p.1.......
013FC0:  53 03 24 03 F6 02 CC 02 A4 02 7E 02 5A 02 38 02    S.$.......~.Z.8.
013FD0:  18 02 FA 01 DE 01 C3 01 AA 01 92 01 7B 01 66 01    ............{.f.
013FE0:  52 01 3F 01 2D 01 1C 01 0C 01 FD 00 EF 00 E1 00    R.?.-...........
013FF0:  D5 00 C9 00 BE 00 B3 00 A9 00 9F 00 96 00 8E 00    ................
014000:  AE 02 AC 00 D7 B4 01 AC 00 B7 02 AC 00 D7 B4 01    ................
014010:  AC 00 AE 02 AD 00 D5 B4 01 AD 00 B7 02 AD 00 D5    ................
014020:  B4 01 AD 00 AE 02 AD 00 D9 B4 01 AD 00 B7 02 AD    ................
014030:  00 AE 02 AE 02 FF AE 02 A7 00 DA B4 01 A7 00 B7    ................
014040:  02 A7 00 DA B4 01 A7 00 AE 02 A7 00 DA B4 01 A7    ................
014050:  00 B7 02 A7 00 DA B4 01 A7 00 AE 02 AA 00 DE B4    ................
014060:  01 AA 00 B7 02 AA 00 DE B4 01 AA 00 AE 02 AA 00    ................
014070:  DE B4 01 AA 00 B7 02 AA 00 DE B4 01 AA 00 AE 02    ................
014080:  A5 00 D9 B4 01 A5 00 B7 02 A5 00 D9 B4 01 A5 00    ................
014090:  AE 02 A5 00 D9 B4 01 A5 00 B7 02 A5 00 D9 B4 01    ................
0140A0:  A5 00 AE 02 AC 00 D7 B4 01 AC 00 B7 02 AC 00 D7    ................
0140B0:  B4 01 AC 00 AE 02 AC 00 D7 B4 01 AC 00 B7 02 AC    ................
0140C0:  00 AE 02 AE 02 FF 00 01 46 02 00 4D 02 01 4B 82    ........F..M..K.
0140D0:  46 82 4D 82 46 82 CD 00 4E 03 01 50 82 4E 82 4D    F.M.F...N..P.N.M
0140E0:  82 49 82 4B 82 4D 82 CB 01 49 83 4D 82 44 82 4B    .I.K.M...I.M.D.K
0140F0:  82 44 82 49 82 44 82 C8 01 49 83 4B 82 44 82 49    .D.I.D...I.K.D.I
014100:  82 44 82 48 82 44 82 49 82 CB 01 FF 00 01 46 02    .D.H.D.I......F.
014110:  00 4D 02 01 4B 82 46 82 4D 82 46 82 CD 00 4E 03    .M..K.F.M.F...N.
014120:  01 50 82 4E 82 4D 82 49 82 4B 82 4D 82 CB 01 49    .P.N.M.I.K.M...I
014130:  83 4D 82 44 82 4B 82 44 82 49 82 44 82 C8 01 49    .M.D.K.D.I.D...I
014140:  83 4B 82 44 82 49 82 44 82 48 82 44 82 49 82 CB    .K.D.I.D.H.D.I..
014150:  01 FF AE 02 AA 00 DA B4 01 AA 00 B7 02 AA 00 DA    ................
014160:  B4 01 AA 00 AE 02 AA 00 DA B4 01 AA 00 B7 02 AA    ................
014170:  00 DA B4 01 AA 00 AE 02 AC 00 DE B4 01 AC 00 B7    ................
014180:  02 AC 00 DE B4 01 AC 00 AE 02 AC 00 DE B4 01 AC    ................
014190:  00 B7 02 AC 00 DE B4 01 AC 00 AE 02 AE 00 D9 B4    ................
0141A0:  01 AE 00 B7 02 AE 00 D9 B4 01 AE 00 AE 02 AE 00    ................
0141B0:  D9 B4 01 AE 00 B7 02 AE 00 D9 B4 01 AE 00 AE 02    ................
0141C0:  AA 00 D7 B4 01 AA 00 B7 02 AA 00 D7 B4 01 AA 00    ................
0141D0:  AE 02 AA 00 D7 B4 01 AA 00 B7 02 AA 00 AE 02 AE    ................
0141E0:  02 FF AE 02 A2 00 D9 B4 01 A2 00 B7 02 A2 00 D9    ................
0141F0:  B4 01 A2 00 AE 02 A2 00 D9 B4 01 A2 00 B7 02 A2    ................
014200:  86 00 7F 00 77 00 71 00 6A 00 64 00 5F 00 59 00    ....w.q.j.d._.Y.
014210:  54 00 50 00 4B 00 47 00 43 00 3F 00 3C 00 38 00    T.P.K.G.C.?.<.8.
014220:  35 00 32 00 2F 00 2D 00 2A 00 28 00 26 00 24 00    5.2./.-.*.(.&.$.
014230:  22 00 20 00 1E 00 1C 00 1B 00 19 00 18 00 16 00    ". .............
014240:  15 00 14 00 13 00 12 00 11 00 10 00 0F 00 00 00    ................
014250:  00 00 00 00 00 00 00 00 00 00 00 00 00 01 08 00    ................
014260:  00 00 00 00 00 DF 00 00 00 00 00 00 00 00 00 00    ................
014270:  00 00 00 00 00 00 00 00 02 03 09 00 00 00 00 00    ................
014280:  00 E7 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
014290:  00 00 00 00 04 05 0A 00 00 00 00 00 00 EF 00 00    ................
0142A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0142B0:  00 00 00 00 00 00 00 00 53 54 2D 4D 6F 64 75 6C    ........ST-Modul
0142C0:  65 2E E2 64 22 65 42 65 08 00 62 65 A2 65 42 65    e..d"eBe..be.eBe
0142D0:  10 10 C2 65 02 66 22 66 00 00 DC 5E DC 5E DC 5E    ...e.f"f...^.^.^
0142E0:  00 00 E2 64 42 66 62 66 00 00 E2 64 82 66 42 65    ...dBfbf...d.fBe
0142F0:  08 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
014300:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
014310:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
014320:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
014330:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
014340:  00 00 A2 66 C2 66 DC 5E E2 66 DC 5E DC 5E DC 5E    ...f.f.^.f.^.^.^
014350:  DC 5E DC 5E DC 5E DC 5E DC 5E DC 5E DC 5E DC 5E    .^.^.^.^.^.^.^.^
014360:  DC 5E 00 00 00 00 00 00 00 00 00 00 00 00 00 00    .^..............
014370:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
014380:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
014390:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0143A0:  00 00 0F 0E 0D 0C 0B 0A 0A 0A 0A 0A 0A 0A 0A 0A    ................
0143B0:  0A 0A 0A 0A 0A 0A 0A 0A 09 08 07 06 05 04 03 02    ................
0143C0:  01 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0143D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0143E0:  00 00 01 00 01 00 01 00 01 00 00 00 00 00 00 00    ................
0143F0:  00 00 01 00 01 00 01 00 01 00 00 00 00 00 00 00    ................
014400:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
014410:  11 00 01 00 02 09 4E E5 11 00 C1 02 00 00 00 02    ......N.........
014420:  11 00 C6 02 00 00 00 02 11 00 C2 02 00 00 00 02    ................
014430:  11 00 C7 02 00 00 00 02 11 00 C3 02 00 00 00 02    ................
014440:  11 00 C8 02 00 00 00 02 11 00 C4 02 00 00 00 02    ................
014450:  11 00 C9 02 00 00 00 02 11 00 C5 02 00 00 00 02    ................
014460:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
014470:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
014480:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
014490:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0144A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0144B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0144C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0144D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0144E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0144F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
014500:  00 D9 B4 01 A2 00 AE 02 AA 00 DE B4 01 AA 00 B7    ................
014510:  02 AA 00 DE B4 01 AA 00 AE 02 AA 00 DE B4 01 AA    ................
014520:  00 B7 02 AA 00 DE B4 01 AA 00 AE 02 A7 00 DC B4    ................
014530:  01 A7 00 AE 02 A7 00 DC B4 01 A7 00 AE 02 A7 00    ................
014540:  DC B4 01 A7 00 B7 02 A7 00 D9 B4 01 A7 00 AE 02    ................
014550:  AC 00 D7 B4 01 AC 00 B7 02 AC 00 D7 B4 01 AC 00    ................
014560:  AE 02 AC 00 D7 B4 01 AC 00 B7 02 AC 00 AE 02 AE    ................
014570:  02 FF 22 02 F0 00 2E 02 00 22 82 2E 82 22 82 2E    .."......"..."..
014580:  82 22 82 2E 82 2A 82 36 82 2A 82 36 82 2A 82 36    ."...*.6.*.6.*.6
014590:  82 2A 82 36 82 27 82 33 82 27 82 33 82 27 82 33    .*.6.'.3.'.3.'.3
0145A0:  82 27 82 33 82 25 82 31 82 25 82 31 82 24 82 30    .'.3.%.1.%.1.$.0
0145B0:  82 24 82 30 82 FF 22 02 00 2E 82 22 82 2E 82 22    .$.0.."...."..."
0145C0:  82 2E 82 22 82 2E 82 2A 82 36 82 2A 82 36 82 2A    ..."...*.6.*.6.*
0145D0:  82 36 82 2A 82 36 82 27 82 33 82 27 82 33 82 27    .6.*.6.'.3.'.3.'
0145E0:  82 33 82 27 82 33 82 2C 82 38 82 2C 82 38 82 2C    .3.'.3.,.8.,.8.,
0145F0:  82 38 82 2C 82 38 82 FF 2A 02 00 36 82 2A 82 36    .8.,.8..*..6.*.6
014600:  82 2A 82 36 82 2A 82 36 82 25 82 31 82 25 82 31    .*.6.*.6.%.1.%.1
014610:  82 25 82 31 82 25 82 31 82 2C 82 38 82 2C 82 38    .%.1.%.1.,.8.,.8
014620:  82 2C 82 38 82 2C 82 38 82 2D 82 39 82 2D 82 39    .,.8.,.8.-.9.-.9
014630:  82 2D 82 39 82 2D 82 39 82 FF 27 02 F0 00 33 82    .-.9.-.9..'...3.
014640:  27 82 33 82 27 02 00 33 82 27 82 33 82 2A 82 36    '.3.'..3.'.3.*.6
014650:  82 DE F5 00 DC F5 00 B6 F0 00 DE F5 00 5C 82 DE    .............\..
014660:  F5 01 DC F5 01 AA F0 00 E1 F5 00 5E 02 F5 01 25    ...........^...%
014670:  02 F0 00 31 02 00 25 82 31 82 25 82 31 82 25 82    ...1..%.1.%.1.%.
014680:  31 82 2C 82 57 02 F5 01 D7 F5 01 D9 F5 00 38 02    1.,.W.........8.
014690:  F0 00 55 02 F5 01 52 86 FF 27 02 F0 00 33 82 27    ..U...R..'...3.'
0146A0:  82 33 82 27 02 00 33 82 27 82 33 82 2A 82 36 82    .3.'..3.'.3.*.6.
0146B0:  DE F5 01 DC F5 01 B6 F0 00 DE F5 00 5C 02 F5 01    ............\...
0146C0:  DE F5 01 DC F5 01 AA F0 00 E1 F5 00 5E 02 F5 01    ............^...
0146D0:  25 02 F0 00 31 02 00 25 82 31 82 25 82 31 82 25    %...1..%.1.%.1.%
0146E0:  82 31 82 2C 82 57 02 F5 01 D7 F5 01 D9 F5 00 38    .1.,.W.........8
0146F0:  02 F0 00 55 02 F5 01 D2 F5 01 D5 F5 00 AC F0 00    ...U............
014700:  0D 00 00 01 0F 0F 0F 38 F0 F0 83 0F 0F 0F 08 11    .......8........
014710:  70 00 00 10 B3 FF FF FF DC 80 00 00 10 F0 F0 33    p..............3
014720:  EE 20 F0 10 C0 11 CC 88 00 22 EE EE 0F 0F 0C 07    . ......."......
014730:  0F 0E 14 F0 80 70 F0 F0 A0 22 22 88 00 00 00 00    .....p..."".....
014740:  00 00 00 00 CC 66 00 00 00 00 00 00 00 CC 66 00    .....f........f.
014750:  00 00 00 00 07 0F 0F 0F 0F 0F 0F 0F 0F 0E 00 00    ................
014760:  00 88 00 00 22 00 00 00 00 00 00 00 00 11 00 00    ...."...........
014770:  CC 44 00 00 00 00 00 00 00 00 00 00 00 00 00 00    .D..............
014780:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
014790:  00 11 80 00 00 00 00 00 00 00 00 62 00 00 00 00    ...........b....
0147A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0147B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0147C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0147D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0147E0:  00 00 F0 81 0E 77 EE FF CC 0E 52 48 00 00 00 00    .....w....RH....
0147F0:  00 00 00 00 33 11 88 8B 07 2A 33 11 88 00 00 00    ....3....*3.....
014800:  00 00 0B 3B DD CF FF CF EE 0F 04 00 00 00 00 00    ...;............
014810:  00 00 00 02 0B 0D 01 04 00 00 00 00 00 00 00 00    ................
014820:  00 07 08 04 00 30 08 00 00 00 00 00 0C 0F 08 00    .....0..........
014830:  00 00 03 77 FF FF FF FF 11 CC CD 08 00 00 00 00    ...w............
014840:  00 00 00 00 00 00 00 23 05 88 00 00 00 00 00 00    .......#........
014850:  00 00 15 00 11 FF FF FF EE 45 00 00 00 00 00 00    .........E......
014860:  01 07 00 00 08 08 00 03 E0 05 00 00 00 00 00 00    ................
014870:  00 00 01 0E 0D 0E 0C 0F 0F 0F 0E 01 00 00 00 00    ................
014880:  00 00 06 FF 33 FF CC 33 FF 33 EE 0C 00 00 00 00    ....3..3.3......
014890:  00 CC 00 00 00 00 07 0B 0F 0F 00 03 0F 44 00 00    .............D..
0148A0:  00 00 00 2A 0F 0F 3B FF 00 0E 00 00 00 00 00 00    ...*..;.........
0148B0:  00 00 00 14 80 70 F0 F0 B0 00 85 00 00 00 00 00    .....p..........
0148C0:  00 00 E0 C1 07 0F 0E 00 01 0F 0F 0F 00 00 00 00    ................
0148D0:  00 00 00 1D FF FF CC FF FF FF 06 00 00 00 00 00    ................
0148E0:  8A 0F 0F 08 00 00 03 0F 0F 0F 00 03 0F 2A 00 00    .............*..
0148F0:  00 00 00 3B CD 0F 3B FF FF FF FF 04 00 00 00 00    ...;..;.........
014900:  D7 F5 01 38 02 F0 00 FF 27 02 F0 00 33 82 27 82    ...8....'...3.'.
014910:  33 82 27 02 00 33 82 27 82 33 82 2A 82 36 82 DE    3.'..3.'.3.*.6..
014920:  F5 01 DC F5 01 B6 F0 00 DE F5 00 5C 02 F5 01 DE    ...........\....
014930:  F5 01 DC F5 01 AA F0 00 E1 F5 00 5E 02 F5 01 25    ...........^...%
014940:  02 F0 00 31 02 00 25 82 31 82 25 82 31 82 25 82    ...1..%.1.%.1.%.
014950:  31 82 2C 82 57 02 F5 01 D7 F5 01 D9 F5 00 38 02    1.,.W.........8.
014960:  F0 00 55 02 F5 01 D2 F5 01 D5 F5 00 AC F0 00 D7    ..U.............
014970:  F5 01 38 02 F0 00 FF 27 02 F0 00 33 82 27 82 33    ..8....'...3.'.3
014980:  82 27 02 00 33 82 27 82 33 82 2A 82 36 82 2A 82    .'..3.'.3.*.6.*.
014990:  59 02 F5 01 59 82 D7 F5 01 D9 F5 01 AA F0 00 D7    Y...Y...........
0149A0:  F5 01 59 02 F5 00 25 02 F0 00 31 02 00 25 82 31    ..Y...%...1..%.1
0149B0:  82 25 82 31 82 25 82 31 82 2C 82 57 02 F5 01 D7    .%.1.%.1.,.W....
0149C0:  F5 01 D9 F5 00 38 02 F0 00 55 02 F5 01 52 82 2C    .....8...U...R.,
0149D0:  02 00 38 82 FF 46 02 F1 00 4D 02 01 4B 82 46 82    ..8..F...M..K.F.
0149E0:  4D 82 46 82 CD 01 4E 83 50 82 4E 82 4D 82 49 82    M.F...N.P.N.M.I.
0149F0:  4B 82 4D 82 CB 01 49 83 4D 82 44 82 4B 82 44 82    K.M...I.M.D.K.D.
014A00:  49 82 44 82 C8 01 49 83 4B 82 44 82 49 82 44 82    I.D...I.K.D.I.D.
014A10:  48 82 44 82 49 82 4B 02 00 FF 46 02 01 4D 82 4B    H.D.I.K...F..M.K
014A20:  82 46 82 4D 82 46 82 CD 01 4E 83 50 82 4E 82 4D    .F.M.F...N.P.N.M
014A30:  82 59 02 00 59 82 D7 00 D9 00 CB 01 D7 00 59 02    .Y..Y.........Y.
014A40:  00 4D 02 01 44 82 4B 82 44 82 49 82 44 82 C8 01    .M..D.K.D.I.D...
014A50:  49 83 4B 82 57 02 00 D7 00 D9 00 44 02 01 55 02    I.K.W......D..U.
014A60:  00 52 82 49 02 01 4B 82 FF 2E 02 00 2A 82 30 82    .R.I..K.....*.0.
014A70:  2A 82 31 82 2A 82 30 82 2A 82 31 82 2C 82 30 82    *.1.*.0.*.1.,.0.
014A80:  2C 82 31 82 2C 82 33 82 2C 82 31 82 29 82 30 82    ,.1.,.3.,.1.).0.
014A90:  29 82 31 82 29 82 30 82 29 82 30 82 2A 82 2E 82    ).1.).0.).0.*...
014AA0:  2A 82 30 82 2A 82 2E 82 2A 82 FF 22 02 00 2E 82    *.0.*...*.."....
014AB0:  22 82 2E 82 22 82 2E 82 22 82 2E 82 2A 82 36 82    "..."..."...*.6.
014AC0:  2A 82 36 82 2A 82 36 82 2A 82 36 82 27 82 33 82    *.6.*.6.*.6.'.3.
014AD0:  27 82 33 82 27 82 33 82 27 82 33 82 2C 82 38 82    '.3.'.3.'.3.,.8.
014AE0:  2C 82 38 82 2C 82 38 82 2C 82 38 82 FF 1A 00 00    ,.8.,.8.,.8.....
014AF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
014B00:  00 00 00 05 14 F0 10 F0 4A E0 02 08 00 00 00 03    ........J.......
014B10:  0E 0F 0F 07 0F 06 0F 00 00 03 0F 08 00 00 00 00    ................
014B20:  00 00 00 01 0C 01 0F 0F 00 07 00 00 00 00 00 CD    ................
014B30:  0F 0F 0F 0E CC 00 00 00 00 00 00 88 22 00 00 00    ............"...
014B40:  00 00 00 00 01 77 DD EE FF FF FF FF 77 FF 04 00    .....w......w...
014B50:  00 00 00 02 08 00 0A 00 00 00 00 00 00 00 80 03    ................
014B60:  0F 0B 0D 0E 01 0F 03 08 03 08 01 0C 00 00 00 00    ................
014B70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
014B80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
014B90:  00 00 00 00 00 01 0F 00 00 00 00 00 00 00 00 00    ................
014BA0:  00 00 00 00 00 00 04 00 00 00 00 00 00 00 00 00    ................
014BB0:  00 00 00 00 00 00 00 00 00 03 0F 0E 00 00 00 00    ................
014BC0:  00 00 00 00 00 00 77 CC 00 00 00 30 64 00 00 03    ......w....0d...
014BD0:  D4 00 00 00 00 00 00 01 0F 0F 0C FF 0F EE 00 00    ................
014BE0:  00 00 00 00 00 00 00 31 FB E4 00 00 00 00 00 00    .......1........
014BF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
014C00:  00 00 00 00 00 00 00 00 00 07 0F 0F 00 00 00 00    ................
014C10:  00 00 00 33 00 77 77 FF FF DD 00 00 01 0F 0F 0F    ...3.ww.........
014C20:  00 00 67 0F 0F 0E 77 8F 0C 07 0F 0F 0F 0E 00 00    ..g...w.........
014C30:  00 F0 C0 00 00 00 31 FF EC 00 10 BB 2D 3F AA C0    ......1.....-?..
014C40:  A0 00 20 90 A2 EF 2D 6E C8 00 00 00 00 00 52 02    .. ...-n......R.
014C50:  0A 0A 0A 0A 0A 00 F0 80 00 00 00 00 00 00 00 00    ................
014C60:  00 00 22 BB BB EE 44 FF FF FF FF 00 0F 02 04 00    .."...D.........
014C70:  00 00 02 0A 08 0A 07 0F 0B 00 0E 0F 0F 0E 00 00    ................
014C80:  10 FF FE 73 F2 50 50 70 00 00 00 20 DE 6E FF 2D    ...s.PPp... .n.-
014C90:  FF 00 77 AD 7F BB 5B A8 00 11 72 FE FA FE CB 0F    ..w...[...r.....
014CA0:  78 5A 5A 5A 5A 5A 5A 4A 92 3D FA FA FF F7 22 00    xZZZZZZJ.=....".
014CB0:  00 00 00 44 DD 77 EE 07 0F 0F 0A 0D 02 09 00 00    ...D.w..........
014CC0:  00 00 02 0A 08 0A 07 0F 08 0F 0F 0F 08 00 00 00    ................
014CD0:  00 31 FF FF FF FF FE 00 00 00 00 10 8B 7F 77 FF    .1............w.
014CE0:  9F 00 47 FF FF 77 0E C8 00 00 88 33 FF 44 BB F7    ..G..w.....3.D..
014CF0:  F0 F0 F0 F0 F0 F0 F0 E0 F0 B3 E6 AA BB EE 00 00    ................
014D00:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
014D10:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
014D20:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
014D30:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
014D40:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
014D50:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
014D60:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
014D70:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
014D80:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
014D90:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
014DA0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
014DB0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
014DC0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
014DD0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
014DE0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
014DF0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
014E00:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
014E10:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
014E20:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
014E30:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
014E40:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
014E50:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
014E60:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
014E70:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
014E80:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
014E90:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
014EA0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
014EB0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
014EC0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
014ED0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
014EE0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
014EF0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
014F00:  00 00 00 07 0F 0F 00 00 00 00 00 00 00 00 00 00    ................
014F10:  00 00 44 0A 08 0A 07 0F 08 00 00 00 00 00 00 00    ..D.............
014F20:  00 01 08 00 00 08 00 00 00 00 00 00 00 60 AA AA    .............`..
014F30:  80 00 00 A2 AA B8 00 00 00 00 00 00 00 55 66 EE    .............Uf.
014F40:  55 FD F5 F5 F5 EE EE AA BB AA BB AA AA AA 88 00    U...............
014F50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
014F60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
014F70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
014F80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
014F90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
014FA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
014FB0:  00 00 00 00 00 00 22 00 00 00 00 00 00 00 00 00    ......".........
014FC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
014FD0:  00 00 33 88 00 00 77 FF CC 00 00 00 00 00 00 00    ..3...w.........
014FE0:  00 00 00 00 00 00 00 F0 F0 E0 00 00 00 00 00 00    ................
014FF0:  00 07 09 00 08 00 3F 08 00 00 00 00 00 04 00 00    ......?.........
015000:  00 00 33 CC 00 11 FF FF CC 00 00 00 00 00 00 00    ..3.............
015010:  00 00 0F B0 34 B0 E0 B0 80 00 00 00 00 00 00 00    ....4...........
015020:  00 00 00 22 FF EE 0E 07 09 3B FF CC 00 00 00 00    ...".....;......
015030:  00 00 30 F0 F0 F0 70 F0 D0 A0 70 80 00 00 00 00    ..0...p...p.....
015040:  08 00 00 00 00 00 00 00 00 00 00 00 00 08 00 00    ................
015050:  00 00 00 77 FF CD 00 06 01 3B FF 88 00 00 00 00    ...w.....;......
015060:  03 52 78 B3 00 77 11 70 B0 60 00 00 00 00 00 00    .Rx..w.p.`......
015070:  00 00 FF 66 FF FF 99 FF FF FF FF FF FF 00 00 00    ...f............
015080:  00 70 F0 F0 F0 F0 E0 1C F0 F0 F0 B0 70 F0 80 00    .p..........p...
015090:  02 02 08 00 00 07 3F 8C 03 00 27 00 06 01 00 00    ......?...'.....
0150A0:  00 33 FF FF 77 FF FF FF FF FF FF FF FF CC 00 00    .3..w...........
0150B0:  1E 38 B0 90 F0 E0 F0 D0 70 B0 80 00 00 00 00 00    .8......p.......
0150C0:  00 00 00 33 FF CD 0E 00 03 1D DD 88 00 00 00 00    ...3............
0150D0:  C0 F0 F0 F0 F0 F0 80 00 00 F0 70 E0 F0 F0 80 00    ..........p.....
0150E0:  00 00 11 FF 8C 7F FF FF EF 13 FF CC 00 00 00 00    ................
0150F0:  00 00 00 33 FF CC 0F 0F 0E 77 FF 88 00 00 00 00    ...3.....w......
015100:  00 47 57 2D 43 4C 49 50 20 53 43 52 00 00 00 00    .GW-CLIP SCR....
015110:  00 00 02 00 00 00 40 00 00 40 00 40 00 00 00 00    ......@..@.@....
015120:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
015130:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
015140:  00 40 00 FD 03 00 00 47 57 2D 43 4C 49 50 20 24    .@.....GW-CLIP $
015150:  24 24 FF 00 FF 00 00 00 00 00 00 00 00 02 B8 00    $$..............
015160:  31 00 1A 00 00 00 00 00 00 00 00 00 00 00 00 00    1...............
015170:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
015180:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
015190:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0151A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0151B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0151C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0151D0:  00 00 22 00 00 00 77 FF 88 00 00 00 00 00 00 00    .."...w.........
0151E0:  00 00 00 00 00 00 00 70 F0 F0 00 00 00 00 00 00    .......p........
0151F0:  00 00 00 0C 07 0F FF 8C 00 01 08 00 00 08 00 00    ................
015200:  00 00 77 00 00 00 FF FF 88 00 00 00 00 00 00 00    ..w.............
015210:  00 00 07 48 D2 50 F0 70 00 00 00 00 00 00 00 00    ...H.P.p........
015220:  00 00 00 77 FF FF 07 0D 0F 77 BB EE 00 00 00 00    ...w.....w......
015230:  00 00 00 F0 F0 F0 B0 70 E0 70 F0 80 00 00 00 00    .......p.p......
015240:  04 00 00 00 00 00 00 00 00 00 00 00 01 00 0C 00    ................
015250:  00 00 00 77 FF CD 08 0F 01 77 FF 88 00 00 00 00    ...w.....w......
015260:  03 29 B4 B3 00 44 33 70 A0 60 00 00 00 00 00 00    .)...D3p.`......
015270:  00 00 33 66 FF FF 06 33 FF FF FF BB 88 00 00 00    ..3f...3........
015280:  00 30 F0 F0 F0 F0 F0 30 F0 80 F0 B0 B0 F0 80 00    .0.....0........
015290:  02 01 08 00 00 00 37 8C 00 00 02 00 00 02 00 00    ......7.........
0152A0:  00 11 FF FF FF CC 77 FF FF FF FF FF EE 00 00 00    ......w.........
0152B0:  0F B0 B0 F0 F0 E0 70 B0 B0 B0 80 00 00 00 00 00    ......p.........
0152C0:  00 00 00 BB FF 8B 19 FF CC 06 DD AA 00 00 00 00    ................
0152D0:  70 F0 F0 F0 F0 F0 80 00 10 F0 F0 E0 D0 D0 80 00    p...............
0152E0:  00 00 11 FF 08 7F FF FF FF 09 FF CC 00 00 00 00    ................
0152F0:  00 00 00 77 FF 8B 0C 00 07 3B FF 00 00 00 00 00    ...w.....;......
015300:  02 4A A4 CC F0 30 E0 22 F0 E0 00 00 00 00 00 00    .J...0."........
015310:  00 00 00 11 EE 77 FF FF FF CC 11 FF CC 00 00 00    .....w..........
015320:  00 20 F0 B0 F0 B0 D0 20 FF 70 E0 00 00 00 00 00    . ..... .p......
015330:  00 00 00 00 02 01 FF FF 08 08 00 00 00 00 00 00    ................
015340:  00 00 00 33 FF FF FF FF FF EE 00 77 88 00 00 00    ...3.......w....
015350:  00 00 1E 4A D0 F0 F0 F0 80 00 00 00 00 00 00 00    ...J............
015360:  00 00 00 00 00 00 00 00 00 44 00 00 00 00 00 00    .........D......
015370:  00 00 00 60 80 00 00 A0 00 00 00 00 00 00 00 00    ...`............
015380:  00 00 90 F0 10 F0 F0 F0 C0 70 F0 00 70 C0 00 00    .........p..p...
015390:  00 00 00 00 00 00 00 00 11 88 00 00 00 00 00 00    ................
0153A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0153B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0153C0:  00 00 00 00 00 00 00 01 0F 0F 08 00 00 00 00 00    ................
0153D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0153E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0153F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
015400:  00 00 0C 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
015410:  01 08 00 00 01 3F FF FF 8B 1F FF FF CD 08 00 00    .....?..........
015420:  00 00 00 00 00 22 11 A8 00 00 00 60 00 00 F0 E0    .....".....`....
015430:  F0 F0 80 FF FC F0 88 00 00 00 00 00 00 00 55 00    ..............U.
015440:  00 00 00 00 11 44 00 00 00 00 00 00 00 00 00 00    .....D..........
015450:  00 21 07 0F 0D 0F 0F 0E 0F 0F 0B 0F 0F 0F 0F 07    .!..............
015460:  0E 08 00 01 0F 7F 88 33 CD 3F CC 11 EE 0F 08 00    .......3.?......
015470:  00 00 66 70 30 F0 F0 F0 F0 F0 F0 F0 F0 F0 80 70    ..fp0..........p
015480:  C0 70 D0 F0 F0 70 F0 44 00 00 00 00 00 54 82 0E    .p...p.D.....T..
015490:  0F 0F 0F 0F 0F 0F 2A 00 00 00 00 00 00 00 00 00    ......*.........
0154A0:  00 0F 14 14 05 0F 0F 0E 28 28 0B 0F 0F 0F 0F 07    ........((......
0154B0:  0E 08 00 01 0F 0F 0F 0E 70 C0 0F 0F 0F 0F 08 00    ........p.......
0154C0:  9F FF FE 44 00 00 00 00 00 22 B3 FF FF 8F 38 F0    ...D....."....8.
0154D0:  10 F0 00 70 F0 91 CC 88 00 00 00 00 B8 07 0C 0F    ...p............
0154E0:  0B 0F 0F 0F 0F 0F 0F 0E 0E 66 00 00 00 00 00 00    .........f......
0154F0:  33 0F 07 2E 33 88 8F 0E 0F 0F 0B 0F 2E 33 88 47    3...3........3.G
015500:  06 A0 59 20 30 70 70 81 70 F0 00 00 00 00 00 00    ..Y 0pp.p.......
015510:  00 00 00 11 DD FF FF FF FF FF 77 FF 88 00 00 00    ..........w.....
015520:  00 10 F0 B0 F0 F0 F0 E0 FF B8 F0 00 00 00 00 00    ................
015530:  00 00 00 00 02 13 FF FF 8C 4C 00 00 00 00 00 00    .........L......
015540:  00 00 00 33 FF FF FF FF FF FF 33 FF 88 00 00 00    ...3......3.....
015550:  00 01 3C 34 F0 E0 00 F0 C0 00 00 00 00 00 00 00    ..<4............
015560:  00 00 00 22 00 00 00 00 11 CC 00 00 00 00 00 00    ..."............
015570:  00 00 00 60 80 00 10 A0 00 00 00 00 00 00 00 00    ...`............
015580:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
015590:  00 00 00 00 00 00 00 00 33 88 00 00 00 00 00 00    ........3.......
0155A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0155B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0155C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0155D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0155E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0155F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
015600:  00 00 06 F0 F0 D0 F0 E0 F0 F7 D0 F0 D0 F0 D0 F3    ................
015610:  C1 08 00 00 00 1F FF FF 0F 0F FF FF 8F 00 00 00    ................
015620:  00 00 00 00 00 11 EE 54 80 00 00 10 F0 F0 00 30    .......T.......0
015630:  C0 10 B2 F0 E0 00 00 00 00 00 00 00 00 00 55 00    ..............U.
015640:  00 00 00 00 11 CC 00 00 00 00 00 00 00 00 00 00    ................
015650:  00 21 00 00 00 00 00 00 00 00 00 00 00 00 00 00    .!..............
015660:  00 08 00 00 0F FF 88 33 EE 7F CC 11 FF 07 00 00    .......3........
015670:  00 00 11 88 D0 F0 F0 F0 F0 F0 F0 F0 F0 F0 F0 80    ................
015680:  30 80 C0 10 E0 F0 E0 88 00 00 00 00 00 54 C1 0D    0............T..
015690:  0F 0F 0F 0F 01 0F 44 00 00 00 00 00 00 00 00 00    ......D.........
0156A0:  00 01 14 14 05 00 00 02 28 28 0A 00 00 00 01 04    ........((......
0156B0:  02 08 00 01 0F 0F 0F 0F 08 03 0F 0F 0F 0F 08 00    ................
0156C0:  47 FF EC FF FF FF FF FF FF FF 51 FF FF CF 70 F0    G.........Q...p.
0156D0:  F0 F0 F0 10 F0 80 CC 44 00 00 00 00 54 83 0E 0F    .......D....T...
0156E0:  07 0F 0F 0F 0F 0F 0F 0F 19 88 00 00 00 00 00 00    ................
0156F0:  11 03 04 15 00 11 0F 0E 08 08 0B 0F 1F 00 11 07    ................
015700:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
015710:  12 00 01 00 02 09 4E E5 12 00 C1 02 00 00 00 02    ......N.........
015720:  12 00 C6 02 00 00 00 02 12 00 C2 02 00 00 00 02    ................
015730:  12 00 C7 02 00 00 00 02 12 00 C3 02 00 00 00 02    ................
015740:  12 00 C8 02 00 00 00 02 12 00 C4 02 00 00 00 02    ................
015750:  12 00 C9 02 00 00 00 02 12 00 C5 02 00 00 00 02    ................
015760:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
015770:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
015780:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
015790:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0157A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0157B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0157C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0157D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0157E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0157F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
015800:  1B CC 00 01 0F 0F 0F 38 F0 F0 83 0F 0F 0F 08 11    .......8........
015810:  70 F0 F0 F0 B3 FF FF FF DC F0 F0 F0 F0 F0 F0 33    p..............3
015820:  EE 20 80 E0 00 00 CC 88 00 22 CC 22 00 0F 08 07    . ......."."....
015830:  0F 0F 30 F0 F0 70 F0 C0 11 44 55 00 00 00 00 00    ..0..p...DU.....
015840:  00 00 00 00 33 88 00 00 00 00 00 00 00 33 88 00    ....3........3..
015850:  00 00 00 00 03 0F 0F 0F 0F 0F 0F 0F 0F 0C 00 00    ................
015860:  00 44 00 00 44 00 00 00 00 00 00 00 00 11 00 00    .D..D...........
015870:  00 88 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
015880:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
015890:  00 10 B0 E0 00 00 07 0C 00 10 F0 60 00 00 00 00    ...........`....
0158A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0158B0:  00 00 01 0E 00 00 00 00 00 00 00 00 00 00 00 00    ................
0158C0:  00 00 00 00 00 00 04 00 00 00 00 00 00 00 00 00    ................
0158D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0158E0:  00 00 F0 03 19 77 FF FF FF 07 21 C0 00 00 00 00    .....w....!.....
0158F0:  00 00 00 00 22 0E FF 8A 0F 3B EE 0E 88 00 00 00    ...."....;......
015900:  00 00 05 77 FF 8C 7F 8C 7F 06 08 00 00 00 00 00    ...w............
015910:  00 00 00 01 04 01 01 04 00 00 00 00 00 00 00 00    ................
015920:  00 0F 08 04 00 43 0E 00 01 05 04 01 01 0F 00 00    .....C..........
015930:  00 00 03 77 FF FF FF EE 33 FF CD 08 00 00 00 00    ...w....3.......
015940:  00 00 00 00 00 00 00 22 0A 88 00 77 CC 00 00 00    ......."...w....
015950:  00 00 02 FF FF EE EE DD FF 8B 08 00 00 00 00 00    ................
015960:  00 08 0E 01 40 07 00 16 F0 81 00 00 00 00 00 00    ....@...........
015970:  00 00 01 0F 0D 0E 0F 0F 0F 0F 08 00 00 00 00 00    ................
015980:  00 00 06 FF FF FF FF CC FF FF EE 0C 00 00 00 00    ................
015990:  11 03 0F 0F 0F 0F 0B 0B 0F 0F 03 0D 0F 2A 00 00    .............*..
0159A0:  00 00 00 2A 0F 0F 3B FF FF 01 08 00 00 00 00 00    ...*..;.........
0159B0:  00 00 00 14 80 70 E0 70 D0 00 85 00 00 00 00 00    .....p.p........
0159C0:  00 00 A0 E0 07 0F 0F 00 03 0F 0F 0F 00 00 00 00    ................
0159D0:  00 00 00 0E FF BB DD 77 EE EE 0E 00 00 00 00 11    .......w........
0159E0:  07 0F 0F 3B FF FF 8B 0F 0F 0E CD 0F 05 2A 00 00    ...;.........*..
0159F0:  00 00 00 15 EE 0F 3B FF EE FF FF 8A 00 0E 00 00    ......;.........
015A00:  00 00 00 01 05 70 80 F0 E0 F0 05 04 00 40 10 87    .....p.......@..
015A10:  0F 0F 0F 09 0E 01 0F 00 0E 0F 0E 0E 00 00 00 00    ................
015A20:  00 00 00 03 00 00 80 20 00 01 08 00 00 00 22 0F    ....... ......".
015A30:  0F 0F 0F 0F 1D 00 00 00 00 00 00 00 00 00 00 00    ................
015A40:  00 00 00 00 02 FF DD CD 44 33 EE 07 3B EE 08 00    ........D3..;...
015A50:  00 00 00 06 00 00 02 08 00 00 00 00 00 00 00 00    ................
015A60:  07 0F 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
015A70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
015A80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
015A90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
015AA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
015AB0:  00 00 00 00 00 00 00 00 00 07 0F 0F 00 00 00 00    ................
015AC0:  00 00 00 00 00 CC 77 CC 66 00 00 10 C0 04 00 08    ......w.f.......
015AD0:  60 00 00 00 00 00 03 0F 0F 0F 03 0F 08 6E 00 00    `............n..
015AE0:  00 00 00 00 00 00 00 73 F7 C8 00 00 00 00 00 00    .......s........
015AF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 F0 00    ................
015B00:  00 00 00 00 00 00 00 00 00 03 0F 0E 00 00 00 00    ................
015B10:  00 00 00 BB FF DD BB FF FF EE 88 00 03 0F 08 02    ................
015B20:  00 00 66 08 06 03 0D 0C 0F 0F 0F 0F 0F 0E 00 00    ..f.............
015B30:  FB 3F FF 80 00 F0 50 FF 80 00 00 B3 FF 2D 6E BA    .?....P......-n.
015B40:  20 70 20 62 BB 2D 7F EE 80 00 00 00 00 00 A4 0A     p b.-..........
015B50:  0A 00 00 0B 0E 00 5A 5A E0 00 00 00 00 00 00 00    ......ZZ........
015B60:  00 00 22 BB DD DD BB FF EE 01 0E 0F 0E 0A 08 00    ..".............
015B70:  00 00 02 0A 08 0A 07 0F 0B 0D 02 0F 0F 0E 00 00    ................
015B80:  10 FF FE 72 FF FF FF FA F8 80 00 10 BB 7F 44 BB    ...r..........D.
015B90:  DD 88 DD EE 99 77 6E C8 00 44 76 FF FB FA F5 8F    .....wn..Dv.....
015BA0:  0F 0F F0 F0 F0 F0 87 0E C1 79 FE FF FF BB 44 00    .........y....D.
015BB0:  00 00 00 11 00 03 0F 0B 0F 0E 0D 0F 02 0A 00 00    ................
015BC0:  00 00 02 0A 08 0A 07 0F 0F 0F 0F 08 00 00 00 00    ................
015BD0:  00 00 F3 FF FF FF C8 00 00 00 00 10 BB BB FF EF    ................
015BE0:  3F 00 67 3F FF EE EE C8 00 00 11 AA AA BB AA FD    ?.g?............
015BF0:  F7 F0 F0 F0 F0 F0 F0 E0 F0 B3 FD AA FD FD 88 88    ................
015C00:  00 00 00 02 0A F0 00 F0 86 F0 05 04 00 00 00 07    ................
015C10:  0F 0F 0F 07 0E 02 0F 00 00 07 0F 04 00 00 00 00    ................
015C20:  00 00 00 01 06 00 00 00 00 0D 00 00 00 00 11 00    ................
015C30:  00 00 00 00 22 00 00 00 00 00 00 77 CC 00 00 00    ...."......w....
015C40:  00 00 00 00 01 77 DD CC FF FF FF 88 3B FF 04 00    .....w......;...
015C50:  00 00 00 05 00 00 05 00 00 00 00 00 00 00 70 E1    ..............p.
015C60:  0D 0F 0D 0C 00 0E 00 00 00 00 00 00 00 00 00 00    ................
015C70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
015C80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
015C90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
015CA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
015CB0:  00 00 00 00 00 00 00 00 00 07 0F 0F 00 00 00 00    ................
015CC0:  00 00 00 00 00 33 88 33 88 00 00 10 E1 08 00 04    .....3.3........
015CD0:  F0 00 00 00 00 00 00 0F 0F 0F 0C 22 0F 22 00 00    ..........."."..
015CE0:  00 00 00 00 00 00 00 31 FB EC 00 00 00 00 00 00    .......1........
015CF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
015D00:  00 00 00 00 00 00 00 00 00 07 0F 0F 00 00 00 00    ................
015D10:  00 00 00 44 FF AA CC FF FF EE 88 00 02 0B 0F 0F    ...D............
015D20:  00 00 00 07 0F 0C 19 07 03 0F 0F 0F 0F 0E 00 00    ................
015D30:  30 FF FC 00 00 00 F1 FF C8 00 00 D5 8F 97 DD 64    0..............d
015D40:  50 80 D0 31 55 CF 87 DD 80 00 00 00 00 00 42 05    P..1U.........B.
015D50:  05 05 05 05 05 0F 00 F0 00 00 00 00 00 00 00 00    ................
015D60:  00 00 22 CC 77 EE BB FF FF CC 01 0D 0E 05 04 00    ..".w...........
015D70:  00 00 05 05 05 05 07 0F 0A 07 0A 0F 0F 0E 00 00    ................
015D80:  10 FF EC F6 FF F5 F5 A0 80 00 00 31 67 7F BB CF    ...........1g...
015D90:  7F 00 77 1F EE FF 3F 64 00 00 77 FF FF FD E9 0F    ..w...?d..w.....
015DA0:  0F F0 A5 A5 A5 A5 F0 E0 C1 3D F5 F7 55 44 00 00    .........=..UD..
015DB0:  00 00 00 33 77 CC 01 0F 0B 0B 0F 0F 05 05 00 00    ...3w...........
015DC0:  00 00 05 05 05 05 07 0F 0F 0F 0F 0E 00 00 00 00    ................
015DD0:  00 10 FF FF FF FF EC 00 00 00 00 10 47 CC FF 77    ............G..w
015DE0:  5B 00 56 7F 77 99 9F 40 00 00 33 55 FF DD 55 FA    [.V.w..@..3U..U.
015DF0:  FC F0 F0 F0 F0 F0 F0 E0 F0 B2 FB DD 77 FA AA 00    ............w...
015E00:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
015E10:  00 00 00 02 08 19 45 08 00 00 00 00 00 00 00 00    ......E.........
015E20:  00 00 00 0C 01 00 00 00 00 00 00 00 00 00 30 C0    ..............0.
015E30:  00 00 00 10 E0 00 00 00 00 00 00 00 00 00 55 55    ..............UU
015E40:  00 99 55 55 FF AA AA CC 22 EE AA AA AA 55 00 00    ..UU...."....U..
015E50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
015E60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
015E70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
015E80:  00 00 00 00 00 00 11 88 00 00 00 00 00 00 00 00    ................
015E90:  00 00 00 00 00 00 00 00 00 10 80 00 00 00 00 00    ................
015EA0:  00 00 00 00 00 77 FF FF FF 00 00 00 00 00 00 00    .....w..........
015EB0:  00 00 00 00 00 00 33 88 00 00 00 00 00 00 00 00    ......3.........
015EC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
015ED0:  00 00 11 FF 00 00 FF FF CC 00 00 00 00 00 00 00    ................
015EE0:  00 00 00 00 00 00 70 F0 F0 C0 00 F0 00 00 00 00    ......p.........
015EF0:  06 00 00 00 00 00 01 00 00 00 00 00 00 01 00 00    ................
015F00:  00 00 11 FF 88 33 FF FF EE 00 00 33 88 00 00 00    .....3.....3....
015F10:  00 03 29 A4 30 C0 70 A0 60 00 00 00 00 00 00 00    ..).0.p.`.......
015F20:  00 00 00 11 FF EE 0C 01 00 1D FF CC 00 00 00 00    ................
015F30:  00 00 70 F0 F0 F0 F0 F0 C0 70 B0 00 00 00 00 01    ..p......p......
015F40:  07 08 00 00 00 00 01 00 00 00 00 00 02 00 00 00    ................
015F50:  00 00 00 77 FF CD 00 03 08 3B FF 00 00 00 00 00    ...w.....;......
015F60:  07 52 78 B3 00 66 11 70 F0 F0 00 00 00 00 00 00    .Rx..f.p........
015F70:  00 77 FF 66 99 FF FF FF FF FF DD FF FF CC 00 00    .w.f............
015F80:  00 70 F0 F0 F0 F0 C1 1C F0 F0 F0 F0 70 F0 80 00    .p..........p...
015F90:  01 04 09 7F 08 7F FF 8D 7F 09 FF 8C 08 05 00 00    ................
015FA0:  33 FF FF FF 15 FF FF FF FF FF 33 FF FF 00 00 00    3.........3.....
015FB0:  1E 5A 78 F0 80 60 F0 F0 F0 B0 80 00 00 00 00 00    .Zx..`..........
015FC0:  00 00 00 11 FF FF 89 0F 0C FF 77 EE 00 00 00 30    ..........w....0
015FD0:  A0 F0 F0 F0 F0 F0 80 77 66 10 B0 E0 F0 F0 00 00    .......wf.......
015FE0:  00 00 00 77 8C 37 FF FF EF 13 FF 00 00 00 00 00    ...w.7..........
015FF0:  00 00 00 11 FF FF CC 00 77 FF FF CC 00 00 00 00    ........w.......
016000:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016010:  00 00 01 05 05 04 03 0E 00 00 00 00 00 00 00 00    ................
016020:  00 0E 07 00 01 00 00 00 00 00 00 00 00 10 D1 74    ...............t
016030:  00 00 00 71 54 C0 00 00 00 00 00 00 00 00 22 88    ...qT.........".
016040:  AA 66 98 FA FB 55 DD FF 55 DD 55 FF 55 00 00 00    .f...U..U.U.U...
016050:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016060:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016070:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016080:  00 00 00 00 00 00 11 00 00 00 00 00 00 00 00 00    ................
016090:  00 00 00 00 00 00 00 00 00 00 80 00 00 00 00 00    ................
0160A0:  00 00 00 00 00 00 FF FF 88 00 00 00 00 00 00 00    ................
0160B0:  00 00 00 00 00 00 33 00 00 00 00 00 00 00 00 00    ......3.........
0160C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0160D0:  00 00 11 EE 00 00 EE AA 22 00 00 00 00 00 00 00    ........".......
0160E0:  00 00 00 00 00 00 30 F0 F0 E0 00 10 80 00 00 00    ......0.........
0160F0:  01 08 06 00 00 00 03 00 00 00 00 00 00 02 00 00    ................
016100:  00 00 33 EE 00 11 FF FF CC 00 00 00 00 00 00 00    ..3.............
016110:  00 01 1E 0A F0 F0 E0 C0 C0 00 00 00 00 00 00 00    ................
016120:  00 00 00 22 FF EE 0C 03 00 3B FF CC 00 00 00 00    ...".....;......
016130:  00 00 70 F0 F0 F0 F0 F0 F0 D0 B0 00 00 00 00 00    ..p.............
016140:  09 0C 00 00 00 00 00 00 00 00 00 00 01 08 00 00    ................
016150:  00 00 00 33 FF CD 00 06 00 3B FF 88 00 00 00 00    ...3.....;......
016160:  07 25 B4 B3 CC 44 11 70 C0 F0 00 00 00 00 00 00    .%...D.p........
016170:  00 11 FF EE BB FF 77 FF FF FF FF DD FF EE 00 00    ......w.........
016180:  00 70 F0 F0 F0 F0 E0 1C F0 F0 F0 F0 70 F0 80 00    .p..........p...
016190:  01 04 08 07 08 7F FF 8C 27 00 7F 08 09 09 00 00    ........'.......
0161A0:  00 FF FF FF 33 FF FF FF FF FF BB FF FF 88 00 00    ....3...........
0161B0:  0F 84 34 F0 F0 E0 E0 E0 F0 B0 80 00 00 00 00 00    ..4.............
0161C0:  00 00 00 11 FF EE 07 0F 0F 33 BB CC 00 00 00 00    .........3......
0161D0:  E0 F0 F0 F0 F0 F0 80 00 00 70 F0 E0 F0 F0 00 00    .........p......
0161E0:  00 00 00 FF 8C 7F FF FF EF 13 FF 88 00 00 00 00    ................
0161F0:  00 00 00 33 FF FF 03 0F 19 FF FF CC 00 00 00 00    ...3............
016200:  01 5A 58 B3 CC 00 77 B8 B0 C0 00 00 00 00 00 00    .ZX...w.........
016210:  00 00 00 33 FF EE 77 FF CC EE 00 00 EE 00 00 00    ...3..w.........
016220:  00 30 F0 D0 F0 30 E0 C0 10 F0 80 00 00 00 00 00    .0...0..........
016230:  00 00 00 00 01 00 04 01 01 00 00 00 00 00 00 00    ................
016240:  00 00 00 77 FF 88 00 FF FF CC 00 00 EE 00 00 00    ...w............
016250:  00 00 01 1E 12 78 F0 C0 00 00 00 00 00 00 00 00    .....x..........
016260:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016270:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016280:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016290:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0162A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0162B0:  00 00 00 0C 00 00 00 00 00 00 00 00 00 00 00 00    ................
0162C0:  03 00 00 00 00 00 03 0F 0F 0F 0F 0C 00 00 00 00    ................
0162D0:  00 00 00 00 00 00 00 00 00 CC 00 00 00 00 00 00    ................
0162E0:  00 00 22 00 00 00 00 00 00 00 00 00 00 00 00 00    ..".............
0162F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016300:  00 01 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016310:  00 08 00 00 03 7F FF FF CD 3F FF FF EE 0C 00 00    .........?......
016320:  00 00 00 00 00 54 D0 20 70 E0 00 00 00 00 00 00    .....T. p.......
016330:  00 10 80 00 77 B8 22 00 00 00 00 00 00 00 55 00    ....w.".......U.
016340:  00 00 00 00 11 44 00 00 00 00 00 00 00 00 00 00    .....D..........
016350:  00 41 14 14 05 70 F0 82 28 28 0A E0 D0 D0 C1 14    .A...p..((......
016360:  82 08 00 01 0F 3F FF FF 8B 1F FF FF CD 0F 08 00    .....?..........
016370:  00 66 70 90 F0 F0 F0 F0 F0 F0 F0 F0 C0 70 F0 10    .fp..........p..
016380:  F0 F0 E0 F0 F0 70 F0 44 00 00 00 00 00 B8 06 0B    .....p.D........
016390:  0F 0F 0F 0F 0F 0F 0E 88 00 00 00 00 00 00 00 00    ................
0163A0:  00 0F 14 14 05 0F 0F 0E 28 28 0B 0F 0F 0F 0F 07    ........((......
0163B0:  0E 08 00 01 0F 0F 0F 1C F0 F0 07 0F 0F 0F 08 11    ................
0163C0:  11 77 FF A2 00 00 00 00 00 B8 77 FF DD 8F 0E 00    .w........w.....
0163D0:  00 70 F0 40 30 D1 EE 88 00 00 00 22 E0 0F 0C 0F    .p.@0......"....
0163E0:  0E 0F 07 0D 0E 0F 0F 07 0F 0E 44 00 00 00 00 00    ..........D.....
0163F0:  33 8F 00 00 AA AA 00 00 00 00 00 00 00 AA AA 00    3...............
016400:  03 A5 01 77 30 B0 80 DC E0 E0 00 00 00 00 00 00    ...w0...........
016410:  00 00 00 11 FF 99 FF FF FF 22 00 33 CC 00 00 00    .........".3....
016420:  00 30 70 B0 E0 B0 D0 90 66 F0 C0 00 00 00 00 00    .0p.....f.......
016430:  00 00 00 00 02 00 7F FF 09 00 00 00 00 00 00 00    ................
016440:  00 00 00 77 FF FF 77 FF FF CC 00 11 CC 00 00 00    ...w..w.........
016450:  00 00 07 A4 D0 F0 F0 F0 00 00 00 00 00 00 00 00    ................
016460:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016470:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016480:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016490:  00 00 00 00 00 00 00 00 00 88 00 00 00 00 00 00    ................
0164A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0164B0:  00 00 00 07 0F 0F 0F 0F 0F 0F 0F 0F 0F 0F 0F 0F    ................
0164C0:  0C 00 00 00 00 00 00 0F 0F 0F 0F 00 00 00 00 00    ................
0164D0:  00 00 00 00 00 00 00 00 00 33 FF FF FF FF FF FF    .........3......
0164E0:  FF FF EE 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0164F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016500:  00 00 0F 0F 0F 0F 0F 0F 0F 0F 0F 0F 0F 0F 0F 0F    ................
016510:  0F 08 00 00 03 7F FF FF CD 3F FF FF EE 0C 00 00    .........?......
016520:  00 00 00 00 00 55 E0 40 00 10 F0 80 00 00 F7 FF    .....U.@........
016530:  FF FE 80 11 FF 88 C4 00 00 00 00 00 00 00 55 00    ..............U.
016540:  00 00 00 00 11 44 00 00 00 00 00 00 00 00 00 00    .....D..........
016550:  00 41 04 04 05 00 00 02 08 08 0A 00 00 00 01 04    .A..............
016560:  02 08 00 01 0F 7F CC 77 CD 3F EE 33 EE 0F 08 00    .......w.?.3....
016570:  00 11 98 E0 F0 F0 F0 F0 F0 F0 F0 F0 F0 80 70 E0    ..............p.
016580:  30 F0 E0 F0 F0 70 F0 44 00 00 00 00 00 B8 06 07    0....p.D........
016590:  0F 0F 0F 0F 0F 0F 1D 00 00 00 00 00 00 00 00 00    ................
0165A0:  00 0F 14 14 05 0F 0F 0E 28 28 0B 0F 0F 0F 0F 07    ........((......
0165B0:  0E 08 00 01 0F 0F 0F 1C F0 F0 07 0F 0F 0F 08 00    ................
0165C0:  9F 88 32 77 FF FF FF FF FF DC 66 00 33 8F 1C E0    ..2w......f.3...
0165D0:  00 80 F0 70 C0 51 EE 88 00 00 00 11 70 07 0C 0F    ...p.Q......p...
0165E0:  0D 0F 0F 0F 0F 0F 0E 0F 0B 19 88 00 00 00 00 00    ................
0165F0:  33 0F 07 2E CC 66 47 0E 0F 0F 0B 0F 2E CC 66 47    3....fG.......fG
016600:  19 CC 00 01 0F 0F 0F 1C F0 F0 07 0F 0F 0F 08 00    ................
016610:  B8 F0 F0 F0 80 00 00 00 10 F0 F0 F0 F0 F0 F0 33    ...............3
016620:  EE 30 80 EE 11 00 11 00 00 00 00 00 00 FF FF FF    .0..............
016630:  FF 00 00 00 00 44 FF CC 44 88 00 00 00 00 00 00    .....D..D.......
016640:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016650:  00 00 00 00 00 0F 0F 0F 0F 0F 0F 0F 0F 00 00 00    ................
016660:  00 11 88 11 00 00 00 00 00 00 00 00 00 00 88 00    ................
016670:  11 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016680:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016690:  00 00 F0 5A 48 00 01 00 00 F0 F0 C0 00 00 00 00    ...ZH...........
0166A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0166B0:  00 00 05 66 07 00 01 0C 03 0E 00 00 00 00 00 00    ...f............
0166C0:  00 00 00 00 04 08 0A 00 00 00 00 00 00 00 00 00    ................
0166D0:  00 00 00 00 00 00 00 00 00 00 00 00 10 00 00 00    ................
0166E0:  00 00 00 0E FF BB BB 55 FF 66 0E 00 00 00 00 00    .......U.f......
0166F0:  00 00 00 00 45 07 07 0A 0F 0B 0D 07 44 00 00 00    ....E.......D...
016700:  00 01 0C 33 FF 09 37 09 37 88 00 00 00 00 00 00    ...3..7.7.......
016710:  00 00 00 02 01 02 00 0C 00 00 00 00 00 00 00 00    ................
016720:  00 0F 0F 0E 00 03 08 06 00 00 03 0F 0F 00 00 00    ................
016730:  00 00 06 FF FF FF FF DD FF FF EE 0C 00 00 00 00    ................
016740:  00 00 00 00 00 00 00 88 00 44 11 07 1D 00 00 00    .........D......
016750:  00 00 01 77 FF FF FF FF EE 04 00 00 00 00 00 00    ...w............
016760:  00 00 0E 00 F0 C3 0F 80 30 E0 08 00 00 00 00 00    ........0.......
016770:  00 00 00 0F 0D 0D 0F 08 03 0F 08 00 00 00 00 00    ................
016780:  00 00 03 77 FF FF FF EE 33 FF CD 08 00 00 00 00    ...w....3.......
016790:  45 0B 0F 0F 0F 0F 09 0D 0F 0F 0B 0E 0F 2A 00 00    E............*..
0167A0:  00 00 01 77 07 0F 1D FF FF FF 8A 00 00 00 00 00    ...w............
0167B0:  00 00 00 02 F0 F0 C0 30 D0 F0 C1 00 00 00 00 00    .......0........
0167C0:  00 03 09 10 0F 0F 0F 0F 0F 0F 0F 0E 00 00 00 00    ................
0167D0:  00 00 00 03 08 FF FF FF FF 03 08 00 00 00 00 11    ................
0167E0:  07 0F 0F 1D 00 00 22 0F 0F 0E CD 0E 0D 44 00 00    ......"......D..
0167F0:  00 00 00 02 FF 07 3B FF BB FF FF 8B 08 EE 08 00    ......;.........
016800:  37 CC 00 01 0F 0F 0F 38 F0 F0 83 0F 0F 0F 08 00    7......8........
016810:  B8 00 00 10 B3 FF FF FF DC 80 00 00 10 F0 F0 33    ...............3
016820:  EE 20 70 11 EE 00 11 00 00 33 CC 11 FF 00 00 00    . p......3......
016830:  00 0F 18 F0 F0 80 00 33 EE 88 22 00 00 00 00 00    .......3..".....
016840:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016850:  00 00 00 00 01 0F 0F 0F 0F 0F 0F 0F 0F 08 00 00    ................
016860:  00 22 00 00 88 00 00 00 00 00 00 00 00 00 88 00    ."..............
016870:  00 88 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016880:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016890:  00 00 61 B4 80 00 01 00 00 70 F0 80 00 00 00 00    ..a......p......
0168A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0168B0:  00 00 02 01 08 0F 0E 00 00 00 00 00 00 00 00 00    ................
0168C0:  00 00 00 00 07 00 0A 00 00 00 00 00 00 00 00 00    ................
0168D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 E0 00 00    ................
0168E0:  00 00 60 07 77 77 BB BB FF 8B 18 80 00 00 00 00    ..`.ww..........
0168F0:  00 00 00 00 45 03 00 02 0F 08 01 03 44 00 00 00    ....E.......D...
016900:  00 00 02 FF FF 08 37 08 37 06 08 00 00 00 00 00    ......7.7.......
016910:  00 00 00 01 09 08 0F 02 00 00 00 00 00 00 00 00    ................
016920:  00 0F 0E 06 00 07 0D 09 04 00 03 02 07 0C 00 00    ................
016930:  00 00 06 FF FF FF FF EE 77 FF EE 0C 00 00 00 00    ........w.......
016940:  00 00 00 00 00 00 00 EF 05 CC 00 88 22 00 00 00    ............"...
016950:  00 00 02 FF FF FF 11 33 FF 8A 07 00 00 00 00 00    .......3........
016960:  00 07 01 0E F0 00 03 04 70 85 00 00 00 00 00 00    ........p.......
016970:  00 00 01 0F 09 0D 0F 0F 0F 0F 08 00 08 00 00 00    ................
016980:  00 00 06 FF FF FF FF CC 77 FF EE 0C 00 00 00 00    ........w.......
016990:  22 0E 00 0F 0F 0F 09 0D 0F 0F 0B 0E 0F 2A 00 00    "............*..
0169A0:  00 00 01 66 0F 0F 1D FF FF EE 04 00 00 00 00 00    ...f............
0169B0:  00 00 00 14 C0 F0 C0 30 D0 90 85 00 00 00 00 00    .......0........
0169C0:  00 01 00 30 07 0F 0F 0F 0F 0F 0F 0E 00 00 00 00    ...0............
0169D0:  00 00 00 07 77 77 EE FF FF 45 0C 00 00 00 00 11    ....ww...E......
0169E0:  07 0F 0F 2A 00 00 44 08 00 00 CD 0F 05 44 00 00    ...*..D......D..
0169F0:  00 00 00 15 EE 0F 3B FF DD FF FF 8A 07 01 00 00    ......;.........
016A00:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
016A10:  13 00 01 00 02 09 50 E5 13 00 C1 02 00 00 00 02    ......P.........
016A20:  13 00 C6 02 00 00 00 02 13 00 C2 02 00 00 00 02    ................
016A30:  13 00 C7 02 00 00 00 02 13 00 C3 02 00 00 00 02    ................
016A40:  13 00 C8 02 00 00 00 02 13 00 C4 02 00 00 00 02    ................
016A50:  13 00 C9 02 00 00 00 02 13 00 C5 02 00 00 00 02    ................
016A60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016A70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016A80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016A90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016AA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016AB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016AC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016AD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016AE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016AF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016B00:  00 00 00 00 0A 18 F0 F0 E0 E0 09 04 00 00 60 07    ..............`.
016B10:  0F 0F 0F 0B 0C 01 0E 09 02 0F 0D 0F 00 00 00 00    ................
016B20:  00 00 00 06 00 00 F8 E2 00 00 0C 00 00 00 22 0F    ..............".
016B30:  0F 0F 0F 0F 1D 00 00 00 00 00 00 00 00 00 00 00    ................
016B40:  00 00 00 00 15 BB 33 CD 3B DD 01 08 04 01 00 00    ......3.;.......
016B50:  00 00 00 00 00 00 05 00 00 00 00 00 00 00 00 00    ................
016B60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016B70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016B80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016B90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016BA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016BB0:  00 00 00 00 00 00 00 00 00 0F 0F 0F 08 00 00 00    ................
016BC0:  00 00 00 00 11 33 FF FF 99 00 00 00 00 02 01 08    .....3..........
016BD0:  00 00 00 00 00 01 0F 0F 0F 08 0F 0E 07 0E 00 00    ................
016BE0:  00 00 00 00 00 00 00 F7 F7 80 00 70 C0 00 00 00    ...........p....
016BF0:  00 00 00 00 00 00 10 F0 00 00 00 00 00 10 87 80    ................
016C00:  00 00 00 00 00 00 00 00 00 00 0F 08 00 00 00 00    ................
016C10:  00 00 11 66 BB DD 77 FF FF EE 88 00 03 0E 05 04    ...f..w.........
016C20:  00 00 45 05 00 0F 8E 03 0F 0F 0C 0F 0F 0E 00 03    ..E.............
016C30:  6F 13 FF F8 F0 A0 F5 FF 80 00 00 D5 7F 9E 3F 55    o.............?U
016C40:  90 80 C0 D5 67 4B FF 5D 80 00 00 00 00 00 D2 05    ....gK.]........
016C50:  00 00 07 0E 01 A5 A5 A5 B4 80 00 00 00 00 00 00    ................
016C60:  00 00 22 AA DD DD FF FF CD 0F 05 0F 0D 04 08 00    ..".............
016C70:  00 00 05 05 05 05 07 0F 0B 08 06 0F 0F 0C 00 00    ................
016C80:  00 F7 EC F6 FF FF FF FF FE 00 00 00 D5 99 FF DD    ................
016C90:  FF 88 FF DD FF CC DD 80 00 00 BB DD EE FD FA E7    ................
016CA0:  0F 0F 0F 0F 0F 0F 0F 0E C1 79 FF FF DD 66 99 00    .........y...f..
016CB0:  00 00 07 0E 06 0F 0F 0F 0F 0F 0F 0E 05 02 00 00    ................
016CC0:  00 00 05 05 05 05 07 0F 0F 0F 0E 00 00 00 00 00    ................
016CD0:  00 00 30 F7 FF FE 80 00 00 00 00 00 D5 FF DD DE    ..0.............
016CE0:  5C 80 D1 5B DD FF DD 80 00 00 33 55 DD DD DD 77    \..[......3U...w
016CF0:  FB FF F0 F0 F0 F0 F0 E0 F0 B2 FE FF FE FE CC 00    ................
016D00:  01 01 04 01 01 02 08 02 01 02 09 00 0A 0A 0A 08    ................
016D10:  00 00 00 00 00 11 00 00 00 00 00 00 00 00 00 00    ................
016D20:  00 00 00 0F 0F 0C 00 00 00 00 00 00 00 00 00 00    ................
016D30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 88    ................
016D40:  00 00 55 44 55 00 00 00 11 11 11 22 44 00 00 00    ..UDU......"D...
016D50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016D60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016D70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016D80:  00 00 00 00 00 00 33 EE 00 00 00 00 00 00 00 00    ......3.........
016D90:  00 00 00 00 00 00 00 00 00 F0 80 00 00 00 00 00    ................
016DA0:  00 00 00 00 07 FF FF FF CF FF 04 03 00 00 00 00    ................
016DB0:  00 00 00 00 00 00 77 EE 00 00 00 00 00 00 00 00    ......w.........
016DC0:  00 00 00 00 0F 0F 08 00 00 00 00 00 00 00 00 00    ................
016DD0:  00 00 00 FF EE 77 FF FF FF CC 33 FF 88 00 00 00    .....w....3.....
016DE0:  00 00 00 00 30 D0 F0 F0 F0 00 70 E0 00 00 00 00    ....0.....p.....
016DF0:  06 07 00 00 00 00 00 00 00 00 00 00 0F 00 08 00    ................
016E00:  00 00 11 FF FF FF 00 FF 11 DD FF FF 00 00 00 00    ................
016E10:  00 0E E0 D1 FF 77 DC F0 D0 80 00 00 00 00 00 00    .....w..........
016E20:  00 00 00 33 FF EE 0F 01 00 15 FF 88 00 00 00 00    ...3............
016E30:  00 10 F0 F0 F0 F0 E0 E0 82 0F 70 80 00 E0 00 00    ..........p.....
016E40:  01 00 00 00 00 00 13 08 00 00 00 00 00 0C 00 00    ................
016E50:  00 00 11 FF FF CD 08 02 00 3B FF 00 00 00 00 00    .........;......
016E60:  0E 58 70 D1 88 CC 00 E0 F0 F0 80 00 00 00 00 00    .Xp.............
016E70:  33 FF FF FF CD 77 FF FF FF FF 15 DD EE 00 00 00    3....w..........
016E80:  00 F0 F0 F0 F0 F0 C1 0E F0 F0 F0 E0 D0 D0 80 00    ................
016E90:  00 08 7F FF 08 7F FF FF FF 09 FF EF 08 02 00 00    ................
016EA0:  00 33 FF FF CD 33 FF FF FF CD 77 FF 00 00 00 00    .3...3....w.....
016EB0:  0D 5A 38 F0 F0 70 F0 F0 F0 F0 80 00 00 00 00 00    .Z8..p..........
016EC0:  00 00 00 00 FF FF FF FF FF FF EE FF 00 00 00 80    ................
016ED0:  00 70 F0 F0 F0 F0 C0 FF FF B8 10 F0 70 E0 00 00    .p..........p...
016EE0:  00 00 00 11 8C 37 FF FF CE 37 CC 00 00 00 00 00    .....7...7......
016EF0:  00 00 00 33 FF FF FF FF FF FF FF EE 00 00 00 00    ...3............
016F00:  07 0C 08 07 01 0E 0F 03 0D 0E 0F 00 0B 0B 0A 00    ................
016F10:  00 00 00 00 01 15 44 00 00 00 00 00 00 00 00 00    ......D.........
016F20:  00 00 00 00 02 03 00 00 00 00 00 00 00 00 00 00    ................
016F30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 22    ..............."
016F40:  44 22 88 AA 77 77 EE 44 FF 33 55 11 11 00 00 00    D"..ww.D.3U.....
016F50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016F60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016F70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016F80:  00 00 00 00 00 00 11 CC 00 00 00 00 00 00 00 00    ................
016F90:  00 00 00 00 00 00 00 00 00 70 80 00 00 00 00 00    .........p......
016FA0:  00 00 00 00 11 FF FF FF FF CC 03 0C 00 00 00 00    ................
016FB0:  00 00 00 00 00 00 77 CC 00 00 00 00 00 00 00 00    ......w.........
016FC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
016FD0:  00 00 00 FF CC 11 FF FF FF 00 00 11 CC 00 00 00    ................
016FE0:  00 00 00 00 00 20 F0 F0 F0 80 30 F0 00 00 00 00    ..... ....0.....
016FF0:  05 08 00 00 00 00 00 00 00 00 00 00 00 00 08 00    ................
017000:  00 00 11 FF CC FF FF FF FF 88 33 FF 00 00 00 00    ..........3.....
017010:  00 07 50 4A CC B3 B8 F0 B0 00 00 00 00 00 00 00    ..PJ............
017020:  00 00 00 11 FF EE 0C 01 0C 15 FF 88 00 00 00 00    ................
017030:  00 00 F0 F0 F0 F0 F0 10 83 08 F0 00 00 00 00 01    ................
017040:  09 00 00 00 00 00 01 00 00 00 00 00 03 00 00 00    ................
017050:  00 00 00 FF FF CD 0E 02 00 3B FF 00 00 00 00 00    .........;......
017060:  06 A4 B4 D1 00 66 11 70 F0 F0 00 00 00 00 00 00    .....f.p........
017070:  11 FF FF EE 8A FF FF FF FF FF 99 DD FF 88 00 00    ................
017080:  00 F0 F0 F0 F0 F0 C1 0E F0 F0 F0 E0 D0 D0 80 00    ................
017090:  01 08 1F FF 08 7F FF DF FF 09 FF CE 08 05 00 00    ................
0170A0:  77 FF FF FF 8A FF FF FF FF EE 3B FF CC 00 00 00    w.........;.....
0170B0:  0D A5 B4 F0 F0 30 F0 F0 F0 B0 80 00 00 00 00 00    .....0..........
0170C0:  00 00 00 00 FF FF EE 00 33 FF EE EE 00 00 00 E0    ........3.......
0170D0:  E0 70 F0 F0 F0 F0 C0 FF FF 40 F0 E0 F0 E0 00 00    .p.......@......
0170E0:  00 00 00 33 8C 37 FF FF CE 13 EE 00 00 00 00 00    ...3.7..........
0170F0:  00 00 00 11 FF FF FF FF FF FF FF EE 00 00 00 00    ................
017100:  00 1E 1A 78 33 FF 98 F0 F0 80 00 00 00 00 00 00    ...x3...........
017110:  00 00 00 33 EE 00 00 11 FF EE 00 00 11 00 00 00    ...3............
017120:  00 00 70 E0 F0 D0 F0 B0 F0 90 00 00 00 00 00 00    ..p.............
017130:  00 00 00 00 00 08 01 0C 02 00 00 00 00 00 00 00    ................
017140:  00 00 00 77 00 00 00 11 FF 88 00 00 00 00 00 00    ...w............
017150:  00 00 00 00 0F 78 80 00 00 00 00 00 00 00 00 00    .....x..........
017160:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
017170:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
017180:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
017190:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0171A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0171B0:  00 00 03 70 F0 C0 00 00 F0 F3 C0 00 00 00 10 F3    ...p............
0171C0:  C1 08 00 00 00 01 0F 0F 0F 0F 0F 0F 08 00 00 00    ................
0171D0:  00 00 00 00 00 00 00 00 44 C0 00 00 30 B0 80 00    ........D...0...
0171E0:  00 10 A2 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0171F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
017200:  00 21 07 0F 1C 1A 02 50 02 5A 50 18 02 1A 5A 07    .!.....P.ZP...Z.
017210:  0E 08 00 00 07 FF FF FF EE 7F FF FF FF 06 00 00    ................
017220:  00 00 00 00 11 CC 00 00 00 70 F0 F0 F0 F0 E0 00    .........p......
017230:  00 10 80 E0 30 F0 D1 00 00 00 00 00 00 11 02 33    ....0..........3
017240:  FF FF FF FF CC 22 00 00 00 00 00 00 00 00 00 00    ....."..........
017250:  00 41 14 14 05 70 B0 82 28 28 0A F0 D0 F0 C1 14    .A...p..((......
017260:  82 08 00 01 0F 0E 77 CC 0F 0F 33 EE 07 0F 08 00    ......w...3.....
017270:  11 70 E0 F0 F0 F0 F0 F0 F0 F0 F0 10 F0 E0 30 F0    .p............0.
017280:  F0 F0 E0 F0 F0 A0 00 44 00 00 00 00 11 60 0E 0D    .......D.....`..
017290:  0F 0F 0F 0F 0F 0F 0F 2A 00 00 00 00 00 00 00 00    .......*........
0172A0:  00 03 14 14 05 0F 0F 0E 28 28 0B 0F 0F 0F 0F 07    ........((......
0172B0:  0E 08 00 01 0F 0F 0F 38 F0 F0 83 0F 0F 0F 08 22    .......8......."
0172C0:  F0 F0 F0 C0 00 00 00 00 00 70 F0 F0 F0 F0 F0 80    .........p......
0172D0:  CC 60 30 C0 30 51 EE 88 00 55 11 B8 83 0F 0C 07    .`0.0Q...U......
0172E0:  0F 07 0F 0F 07 0F 0F 0F 18 A2 44 DD 00 00 00 00    ..........D.....
0172F0:  00 11 FF DD 30 91 77 FF FF FF FF FF DD 30 91 77    ....0.w......0.w
017300:  01 2D 85 C0 FF FF EE 70 F0 C0 00 00 00 00 00 00    .-.....p........
017310:  00 00 00 33 FF CC 00 00 33 EE 00 00 77 00 00 00    ...3....3...w...
017320:  00 10 F0 D0 F0 D0 F0 70 F0 C0 00 00 00 00 00 00    .......p........
017330:  00 00 00 00 01 00 02 02 02 00 00 00 00 00 00 00    ................
017340:  00 00 00 77 CC 00 00 33 FF CC 00 00 22 00 00 00    ...w...3...."...
017350:  00 00 00 07 A5 B4 F0 00 00 00 00 00 00 00 00 00    ................
017360:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
017370:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
017380:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
017390:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0173A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0173B0:  00 00 01 38 F0 D0 F0 E0 F0 F0 D0 F0 D0 F0 D0 F0    ...8............
0173C0:  81 00 00 00 00 00 0F 0F 0F 0F 0F 0F 00 00 00 00    ................
0173D0:  00 00 00 00 00 00 00 00 33 30 F0 F0 F0 F0 F0 F0    ........30......
0173E0:  F0 F0 A2 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0173F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
017400:  00 01 07 0F 0D A5 A5 A5 A5 A5 A5 A5 A5 A5 A5 07    ................
017410:  0E 08 00 00 07 FF FF FF EE 7F FF FF FF 06 00 00    ................
017420:  00 00 00 00 00 22 20 F0 80 00 00 00 00 00 00 00    ....." .........
017430:  00 10 80 00 EE F0 D1 00 00 00 00 00 00 00 8A CC    ................
017440:  00 00 00 00 33 44 00 00 00 00 00 00 00 00 00 00    ....3D..........
017450:  00 41 14 14 05 70 D0 82 28 28 0A 00 00 00 01 14    .A...p..((......
017460:  82 08 00 01 0F 1D FF FF 07 0F FF FF 8B 0F 08 00    ................
017470:  00 98 F0 70 F0 F0 F0 F0 F0 F0 F0 E0 30 F0 C0 F0    ...p........0...
017480:  F0 F0 E0 F0 F0 70 10 44 00 00 00 00 11 60 0E 0D    .....p.D.....`..
017490:  0F 0F 0F 0F 0F 0F 0F 44 00 00 00 00 00 00 00 00    .......D........
0174A0:  00 0F 14 14 05 0F 0F 0E 28 28 0B 0F 0F 0F 0F 07    ........((......
0174B0:  0E 08 00 01 0F 0F 0F 38 F0 F0 83 0F 0F 0F 08 22    .......8......."
0174C0:  C0 00 00 33 FF FF FF FF FF 00 00 00 00 00 00 C0    ...3............
0174D0:  00 70 C0 30 C0 51 EE 88 00 77 00 54 C1 0F 0C 0F    .p.0.Q...w.T....
0174E0:  0E 0F 07 0E 0F 07 0F 0B 0E 01 3B 33 00 00 00 00    ..........;3....
0174F0:  11 67 0F 5D 76 DD 47 0F 0F 0F 0F 0F 5D 76 DD 47    .g.]v.G.....]v.G
017500:  00 00 00 00 0F 0F 0F 0E 70 C0 0F 0F 0F 0F 00 00    ........p.......
017510:  54 F0 F0 F0 F0 F0 F0 F0 F0 F0 F0 F0 F0 F0 E0 33    T..............3
017520:  EE 33 88 00 00 77 CC 00 00 00 00 00 00 00 00 00    .3...w..........
017530:  00 00 00 AA 00 AA 00 00 22 00 00 00 00 00 00 00    ........".......
017540:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
017550:  00 00 00 00 00 00 0F 0F 0F 0F 0F 0F 00 00 00 00    ................
017560:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 11 FF    ................
017570:  88 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
017580:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
017590:  00 10 F0 F0 00 0F 0F 0F 0E 30 F0 A4 00 00 00 00    .........0......
0175A0:  00 00 00 00 00 00 00 11 FF 00 00 00 00 00 00 00    ................
0175B0:  00 00 0B 1D FF FF FF CC 33 06 08 00 00 00 00 00    ........3.......
0175C0:  00 00 02 04 00 0A 05 00 00 00 00 00 00 00 00 00    ................
0175D0:  00 00 0F 00 00 00 00 00 00 00 00 00 10 00 80 00    ................
0175E0:  00 00 01 1D FF FF BB BB FF 77 07 00 00 00 00 00    .........w......
0175F0:  00 00 00 00 22 0E FF 8B 0F 3B EE 0E 88 00 00 00    ...."....;......
017600:  00 00 15 FF CC 00 DE B7 88 02 03 00 00 00 00 00    ................
017610:  00 00 00 00 02 00 00 0D 08 00 00 00 00 00 00 00    ................
017620:  00 03 03 0E 02 03 0C 0B 00 00 07 0F 08 00 00 00    ................
017630:  00 00 06 FF 55 FF 9A 3B FF DD EE 0C 00 00 00 00    ....U..;........
017640:  00 00 00 00 00 00 CC 02 09 11 22 0F 0E 88 00 00    ..........".....
017650:  00 00 00 06 33 FF FF CC 06 00 00 00 00 00 00 00    ....3...........
017660:  00 00 00 14 F0 C3 3C 00 30 F0 04 00 00 00 00 00    ......<.0.......
017670:  00 00 07 06 0F 0B 0E 00 01 0F 08 01 08 00 00 00    ................
017680:  00 00 03 2A FF FF FF FF DD FF 03 08 00 00 00 00    ...*............
017690:  8B 0F 0F 0B 0F 0F 01 0B 05 05 09 0E 0F 2A 00 00    .............*..
0176A0:  00 00 01 77 07 0F 1D FF FF FF EE 08 00 00 00 00    ...w............
0176B0:  00 00 00 03 70 F0 F0 F0 86 F0 41 00 00 00 00 00    ....p.....A.....
0176C0:  03 0F 0F 0F 0F 0E 07 0F 0F 0F 0F 0C 00 00 00 00    ................
0176D0:  00 00 00 0C 0F 19 EE FF 03 0E 06 00 00 00 00 22    ..............."
0176E0:  0F 0F 0F 1D 00 00 00 FF FF FF AA 0E 06 88 00 00    ................
0176F0:  00 00 00 00 3B CD 3B FF 77 FF FF FF FF FF 04 00    ....;.;.w.......
017700:  00 00 00 01 0F 0F 0F 1C F0 F0 07 0F 0F 0F 08 00    ................
017710:  B8 F0 F0 F0 F0 F0 F0 F0 F0 F0 F0 F0 F0 F0 F0 33    ...............3
017720:  EE 40 77 00 00 88 22 00 00 00 00 00 00 00 00 00    .@w...".........
017730:  00 FF FF 55 FF DD 00 00 55 00 00 00 00 00 00 00    ...U....U.......
017740:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
017750:  00 00 00 00 00 03 0F 0F 0F 0F 0F 0F 0C 00 00 00    ................
017760:  00 00 77 EE 00 00 00 00 00 00 00 00 00 00 66 00    ..w...........f.
017770:  66 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    f...............
017780:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
017790:  00 00 F0 E1 C0 01 0C 07 00 F0 F0 48 00 00 00 00    ...........H....
0177A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0177B0:  00 00 0B 3B 88 FF EE 03 0C 01 00 00 00 00 00 00    ...;............
0177C0:  00 00 03 08 03 04 0A 00 00 00 00 00 00 00 00 00    ................
0177D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 F0 00 00    ................
0177E0:  00 00 00 1D FF FF BB DD EE FF 06 00 00 00 00 00    ................
0177F0:  00 00 00 00 45 0F 00 03 0F 08 01 0F 44 00 00 00    ....E.......D...
017800:  00 00 15 CC 33 4C 27 4C 7F 8B 0C 00 00 00 00 00    ....3L'L........
017810:  00 00 00 01 0C 00 03 02 00 00 00 00 00 00 00 00    ................
017820:  00 07 0F 0E 01 03 08 02 00 00 07 0F 0C 00 00 00    ................
017830:  00 00 06 FF BB FF CC 33 FF 33 EE 0C 00 00 00 00    .......3.3......
017840:  00 00 00 00 00 00 33 8B 0F 66 22 0F 0E 88 00 00    ......3..f".....
017850:  00 00 00 19 FF FF FF FF 89 08 00 00 00 00 00 00    ................
017860:  00 00 01 0E F0 A5 1E 00 30 E1 04 00 00 00 00 00    ........0.......
017870:  00 00 07 01 0F 0D 0F 00 01 0F 08 00 08 00 00 00    ................
017880:  00 00 03 77 33 FF FF FF 33 CC CD 08 00 00 00 00    ...w3...3.......
017890:  45 07 0F 0F 0F 0F 09 0D 05 05 0B 0E 0F 2A 00 00    E............*..
0178A0:  00 00 01 77 07 0F 0E FF FF FF CD 00 00 00 00 00    ...w............
0178B0:  00 00 00 02 F0 F0 E0 70 E0 F0 C1 00 00 00 00 00    .......p........
0178C0:  00 07 0F 09 0F 0F 0F 0F 0F 0F 0F 0E 00 00 00 00    ................
0178D0:  00 00 00 01 0E 77 EE FF CC 0F 00 00 00 00 00 22    .....w........."
0178E0:  0F 0F 0F 1D 00 00 11 00 00 00 CD 0F 0B 44 00 00    .............D..
0178F0:  00 00 00 01 77 8B 3B FF BB FF FF 88 77 FF 04 00    ....w.;.....w...
017900:  00 00 00 00 0A 01 08 60 00 02 00 0A 00 90 00 03    .......`........
017910:  0F 0F 0F 07 0A 07 0D 0D 0F 0F 03 0F 00 00 00 00    ................
017920:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 FF    ................
017930:  FF FF FF FF CC 00 00 00 00 00 00 00 00 00 00 00    ................
017940:  00 00 00 00 15 55 BB 8A 04 01 00 00 00 00 00 00    .....U..........
017950:  00 00 00 00 00 00 0A 00 00 00 00 00 00 00 00 00    ................
017960:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
017970:  00 00 00 00 00 00 00 00 00 00 00 10 C0 00 00 00    ................
017980:  60 00 00 00 00 00 00 00 00 01 0F 0E 00 00 00 00    `...............
017990:  00 00 00 00 00 00 00 00 F3 FE 00 00 00 00 00 00    ................
0179A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0179B0:  00 00 00 00 00 00 00 00 00 0F 0F 0F 08 00 00 00    ................
0179C0:  00 00 00 00 55 77 FF FF FF 44 00 00 00 07 0F 08    ....Uw...D......
0179D0:  00 00 00 00 07 0F 0F 0F 03 0F 0C 07 0F 0E 00 00    ................
0179E0:  00 00 00 00 00 00 10 FF FE 00 10 55 55 70 00 20    ...........UUp. 
0179F0:  80 00 00 A0 00 70 55 55 40 00 00 00 00 00 A5 3C    .....pUU@......<
017A00:  0F 0F 0F 78 E0 00 00 00 00 00 00 00 00 00 00 00    ...x............
017A10:  00 00 22 EE 55 EE DD FF FF FF 44 00 07 09 05 00    ..".U.....D.....
017A20:  00 00 05 05 05 15 67 0F 0F 09 0E 0F 0F 0E 00 01    ......g.........
017A30:  7F 3F FF A0 B1 F5 FF FE 00 00 00 51 5B 77 2D DD    .?.........Q[w-.
017A40:  74 70 71 55 AD 7F 56 5C 00 00 F8 F7 F8 F9 96 3C    tpqU..V\.......<
017A50:  07 0C 01 A5 A5 0F A5 A5 A5 1D EE F0 33 55 00 00    ............3U..
017A60:  00 00 11 77 EE 33 77 EE 0F 0B 0E 0F 09 05 00 00    ...w.3w.........
017A70:  00 00 05 05 05 05 07 0F 0A 0F 03 0F 0F 2A 00 00    .............*..
017A80:  00 F7 FF FF F9 FF FF FE 80 00 00 00 D5 FF BB FF    ................
017A90:  DF 00 57 FF EE FF DD 80 00 00 FF FF 11 EE FE F8    ..W.............
017AA0:  C0 07 0F 0F 0F 0F 0F 0E E0 F3 DD 55 FF 66 00 00    ...........U.f..
017AB0:  01 0C 07 0F 0F 0F 0E 00 07 0F 00 07 0F 08 00 00    ................
017AC0:  00 00 05 05 05 05 07 0F 0F 0E 00 00 00 00 00 00    ................
017AD0:  00 00 00 06 00 06 00 00 00 00 00 00 51 77 4B 5B    ............QwK[
017AE0:  64 80 B1 56 1E 7F 54 00 00 00 22 EE 77 FF FF FF    d..V..T...".w...
017AF0:  FA FA FA FA FA FA FB DD F8 B3 FF FE FA FF 99 00    ................
017B00:  00 00 00 00 0A 06 70 F0 10 C1 00 0A 00 80 80 07    ......p.........
017B10:  0F 0F 0F 0B 0D 0D 0D 09 0F 07 09 0F 00 00 00 00    ................
017B20:  00 00 0F 0C 00 00 00 00 00 00 07 0F 00 00 11 00    ................
017B30:  00 00 00 00 22 00 00 00 00 00 00 00 00 00 00 00    ...."...........
017B40:  00 00 00 00 15 66 DD CD 2A EE 0E 00 03 0E 00 00    .....f..*.......
017B50:  00 00 00 00 00 00 05 00 00 00 00 00 00 00 00 00    ................
017B60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
017B70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
017B80:  00 00 00 00 00 00 00 00 00 00 33 00 00 00 00 00    ..........3.....
017B90:  00 00 00 00 00 00 00 00 30 E0 00 00 00 00 00 00    ........0.......
017BA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
017BB0:  00 00 00 00 00 00 00 00 00 0F 0F 0F 08 00 00 00    ................
017BC0:  00 00 00 00 22 FF FF FF EE 88 00 00 00 03 0F 00    ...."...........
017BD0:  00 00 00 00 00 0F 0F 0F 0C 07 0F 09 0F 0E 00 00    ................
017BE0:  00 00 00 00 00 00 00 F7 FF 80 00 A2 B8 80 00 10    ................
017BF0:  00 00 00 40 00 00 E0 AA 80 00 00 00 00 10 4B 48    ...@..........KH
017C00:  F0 F0 F0 80 00 00 00 00 00 00 00 00 00 00 00 00    ................
017C10:  00 00 11 66 AA EE FF FF FF FF 44 00 03 0C 0A 08    ...f......D.....
017C20:  00 00 02 0A 08 08 01 0F 0F 0E 02 0F 0F 0E 00 0F    ................
017C30:  EF 13 FF D8 50 50 FF FE 00 00 00 B3 3F CF 5B AA    ....PP......?.[.
017C40:  D8 00 50 AA DE 1F EF 6E 80 11 77 AA FF 77 A5 C2    ..P....n..w..w..
017C50:  00 02 0C 00 1E 5A 5A 5A 5A 48 33 FF FF CC 00 00    .....ZZZZH3.....
017C60:  00 00 11 22 FF 88 CC FF 03 0D 0E 0F 0C 09 00 00    ..."............
017C70:  00 00 02 0A 08 0A 07 0F 0B 03 0C 0F 0F 2A 00 00    .............*..
017C80:  00 F7 FE FF F7 FF FF FF E8 00 00 00 40 77 FF FF    ............@w..
017C90:  BB 88 EE FF FF FF 10 00 00 00 77 77 FF BB FD E0    ..........ww....
017CA0:  03 0F 0F 0F 0F 0F 0F 0E C1 F1 FF FF FF DD 44 00    ..............D.
017CB0:  00 03 08 01 0F 0F 0D 0F 08 00 0F 08 00 04 00 00    ................
017CC0:  00 00 02 0A 08 0A 07 0F 0F 0F 08 00 00 00 00 00    ................
017CD0:  00 00 00 70 F0 E0 00 00 00 00 00 00 A2 EE 3F AD    ...p..........?.
017CE0:  BA 80 E2 AD EF 3B AA 80 00 00 22 AA BB AA BB BB    .....;....".....
017CF0:  F5 F7 FF F0 F0 F0 F1 E6 F0 B1 F5 FD F7 F5 C4 00    ................
017D00:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
017D10:  14 00 01 00 02 09 4E E5 14 00 C1 02 00 00 00 02    ......N.........
017D20:  14 00 C6 02 00 00 00 02 14 00 C2 02 00 00 00 02    ................
017D30:  14 00 C7 02 00 00 00 02 14 00 C3 02 00 00 00 02    ................
017D40:  14 00 C8 02 00 00 00 02 14 00 C4 02 00 00 00 02    ................
017D50:  14 00 C9 02 00 00 00 02 14 00 C5 02 00 00 00 02    ................
017D60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
017D70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
017D80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
017D90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
017DA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
017DB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
017DC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
017DD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
017DE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
017DF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
017E00:  01 00 08 01 01 02 0C 02 0D 0E 0F 00 0B 0B 0B 08    ................
017E10:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
017E20:  00 00 00 01 08 00 00 00 00 00 00 00 00 00 00 00    ................
017E30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
017E40:  00 00 00 00 00 22 11 11 00 00 00 00 00 00 00 00    ....."..........
017E50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
017E60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
017E70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
017E80:  00 00 00 00 00 00 33 FF 00 00 00 00 00 00 00 00    ......3.........
017E90:  00 00 00 00 00 00 00 00 70 F0 00 00 00 00 00 00    ........p.......
017EA0:  00 00 00 01 09 FF FF FF 0C 7F 8A 00 0C 00 00 00    ................
017EB0:  00 00 00 00 00 00 77 EE 00 00 00 00 00 00 00 00    ......w.........
017EC0:  00 00 00 07 5A 1A 3C 00 00 00 00 00 00 00 00 00    ....Z.<.........
017ED0:  00 00 00 FF FF FF 88 FF 11 EE FF FF 88 00 00 00    ................
017EE0:  00 00 00 10 F0 D0 E0 F0 F0 00 F0 C0 00 00 00 00    ................
017EF0:  01 08 00 00 00 00 00 00 00 00 00 00 04 0C 04 00    ................
017F00:  00 00 00 FF FF EE 0F 66 0E FF FF EE 00 00 00 00    .......f........
017F10:  01 2C C1 B3 99 EE 66 F0 E0 C0 00 00 00 00 00 00    .,....f.........
017F20:  00 00 00 BB 33 EE 0C 01 08 15 FF 88 00 00 00 00    ....3...........
017F30:  00 10 F0 F0 F0 F0 D0 F0 82 0D 70 60 D0 F0 00 00    ..........p`....
017F40:  01 00 08 00 00 00 13 08 00 00 00 00 00 02 00 00    ................
017F50:  00 00 33 FF FF CD 08 00 00 11 FF CC 00 00 00 00    ..3.............
017F60:  0F B0 B0 E0 00 30 F0 D0 30 70 80 00 00 00 00 00    .....0..0p......
017F70:  00 11 FF FF EE 19 FF FF FF EE 3B DD 88 00 00 00    ..........;.....
017F80:  00 F0 F0 F0 F0 F0 80 07 70 F0 F0 E0 A0 A0 80 00    ........p.......
017F90:  00 00 33 FF 08 7F FF FF FF 09 FF EE 00 00 00 00    ..3.............
017FA0:  00 00 77 FF EE 0C FF FF FF 02 FF EE 00 00 00 00    ..w.............
017FB0:  07 B4 14 F0 F0 70 F0 F0 30 70 00 00 00 00 00 00    .....p..0p......
017FC0:  00 00 00 11 77 FF FF FF FF FF DD FF 00 00 00 00    ....w...........
017FD0:  00 70 F0 F0 F0 F0 E0 55 FF B8 C0 70 70 C0 00 00    .p.....U...pp...
017FE0:  00 00 00 00 8C 37 FF FF CE 37 88 00 00 00 00 00    .....7...7......
017FF0:  00 00 00 33 FF FF FF FF FF FF FF FF 00 00 00 00    ...3............
018000:  00 03 5A 78 B0 C0 E0 C0 E0 00 00 00 00 00 00 00    ..Zx............
018010:  00 00 00 33 00 00 00 00 77 CC 00 00 00 00 00 00    ...3....w.......
018020:  00 00 00 F0 80 00 70 E0 00 20 80 00 00 00 00 00    ......p.. ......
018030:  10 F0 F0 F0 F0 F0 F0 F0 F0 F0 F0 F0 F0 F0 C0 00    ................
018040:  00 00 00 44 00 00 00 00 77 88 00 00 00 00 00 00    ...D....w.......
018050:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018060:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018070:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018080:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018090:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0180A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0180B0:  00 00 06 F0 70 D0 F0 E0 F0 F1 D0 F0 D0 F0 D0 F3    ....p...........
0180C0:  C1 08 00 00 00 07 7F CF 0F 0F 3F EF 0E 00 00 00    ..........?.....
0180D0:  00 00 00 00 00 00 00 22 40 00 00 00 20 00 80 00    ......."@... ...
0180E0:  00 10 A2 00 00 00 00 00 00 00 00 00 00 00 77 00    ..............w.
0180F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018100:  00 21 07 0F 1C 5A 5A 5A 5A 5A 5A 5A 5A 5A 5A 07    .!...ZZZZZZZZZZ.
018110:  0E 08 00 00 0F FF 88 33 EE 7F CC 11 FF 07 00 00    .......3........
018120:  00 00 00 77 00 70 F0 F0 F0 F0 F0 F0 F0 F0 F0 F0    ...w.p..........
018130:  C0 70 B0 C0 E0 F0 E0 88 00 00 00 00 00 22 C1 0B    .p..........."..
018140:  0F 0F 0F 0F 0E 06 88 00 00 00 00 00 00 00 00 00    ................
018150:  00 41 14 14 05 70 F0 82 28 28 0A F0 D0 F0 C1 14    .A...p..((......
018160:  82 08 00 01 0F 0F 0F 0F 0F 0F 0F 0F 0F 0F 08 00    ................
018170:  47 FF 88 00 00 00 00 00 00 00 60 33 FF CE F0 F0    G.........`3....
018180:  F0 F0 F0 60 10 A0 00 44 00 00 00 00 54 C1 0E 0F    ...`...D....T...
018190:  07 0F 0F 0F 0F 0F 0F 0E 66 00 00 00 00 00 00 00    ........f.......
0181A0:  00 83 14 14 CC 67 0F 0E 28 28 0B 0F 0F CC 67 07    .....g..((....g.
0181B0:  0D 00 00 01 0F 0F 0F 38 F0 F0 83 0F 0F 0F 08 22    .......8......."
0181C0:  F0 F0 F0 F0 80 00 00 00 10 F0 F0 F0 F0 F0 F0 91    ................
0181D0:  EE 20 30 E0 30 91 EE 88 00 44 11 00 0F 0F 0C 07    . 0.0....D......
0181E0:  0F 0D 0E 00 07 38 F0 C0 70 A2 11 44 00 00 00 00    .....8..p..D....
0181F0:  00 00 00 00 AA AA 00 00 00 00 00 00 00 AA AA 00    ................
018200:  00 07 A5 B4 C0 00 50 F0 D0 00 00 00 00 00 00 00    ......P.........
018210:  00 00 00 33 88 00 00 00 FF CC 00 00 00 00 00 00    ...3............
018220:  00 00 30 F0 10 E0 F0 C0 00 30 80 00 00 00 00 00    ..0......0......
018230:  00 00 00 00 00 04 00 00 04 00 00 00 00 00 00 00    ................
018240:  00 00 00 66 00 00 00 00 FF 88 00 00 00 00 00 00    ...f............
018250:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018260:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018270:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018280:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018290:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0182A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0182B0:  00 00 03 70 B0 D0 F0 E0 F0 F3 D0 F0 D0 F0 D0 F1    ...p............
0182C0:  C1 08 00 00 00 03 0F 0F 0F 0F 0F 0F 0C 00 00 00    ................
0182D0:  00 00 00 00 00 00 00 11 B8 00 00 00 20 00 80 00    ............ ...
0182E0:  00 10 A2 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0182F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018300:  00 21 07 0F 0D 81 A1 85 25 24 84 A1 A0 81 A5 07    .!......%$......
018310:  0E 08 00 00 0F FF CC 77 EE 7F EE 33 FF 07 00 00    .......w...3....
018320:  00 00 00 00 EE 10 F0 F0 F0 F0 F0 F0 F0 F0 F0 F0    ................
018330:  F0 D0 90 E0 90 F0 D1 00 00 00 00 00 00 22 C1 0C    ............."..
018340:  00 00 00 00 03 1D 00 00 00 00 00 00 00 00 00 00    ................
018350:  00 41 14 14 05 70 70 82 28 28 0A F0 D0 90 C1 14    .A...pp.((......
018360:  82 08 00 01 0F 0F 08 03 0F 0F 0C 01 0F 0F 08 00    ................
018370:  22 80 50 F0 F0 F0 F0 F0 F0 F0 C0 C0 00 10 F0 F0    ".P.............
018380:  F0 F0 F0 70 E0 20 00 44 00 00 00 00 22 C1 0E 0E    ...p. .D...."...
018390:  0F 0F 0F 0F 0F 0F 0F 1D 88 00 00 00 00 00 00 00    ................
0183A0:  00 83 14 14 15 8F 0F 0E 28 28 0B 0F 0F 3F 8F 07    ........((...?..
0183B0:  0D 00 00 01 0F 0F 0F 38 F0 F0 83 0F 0F 0F 08 22    .......8......."
0183C0:  F0 F0 F0 F0 F0 F0 F0 F0 F0 F0 F0 F0 F0 F0 F0 91    ................
0183D0:  CC 10 C0 30 C0 51 EE 88 00 55 EE 60 07 0F 0C 07    ...0.Q...U.`....
0183E0:  0F 0B 0F 0F 0F 0C 00 03 70 B3 BB 22 00 00 00 00    ........p.."....
0183F0:  00 00 00 11 76 DD 00 00 00 00 00 00 11 76 DD 00    ....v........v..
018400:  00 00 00 00 07 0F 0F 0F 0F 0F 0F 0F 0F 0E 00 00    ................
018410:  11 88 00 00 33 FF FF FF FF FF FF FF FF FF 00 11    ....3...........
018420:  CC 44 00 00 00 00 00 00 00 00 00 00 00 00 00 00    .D..............
018430:  00 00 11 88 00 00 00 00 00 00 00 00 00 00 00 00    ................
018440:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018450:  00 00 00 00 00 00 00 01 0F 0F 0C 00 00 00 00 00    ................
018460:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018470:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018480:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018490:  00 10 F0 C0 0F 19 EE FF 03 0C A5 E0 00 00 00 00    ................
0184A0:  00 00 00 00 00 EE 00 45 0F 44 00 EE 00 00 00 00    .......E.D......
0184B0:  00 00 0B 1D EE 66 FF 77 45 0F 04 00 00 00 00 00    .....f.wE.......
0184C0:  00 00 00 05 00 05 02 08 00 00 00 00 00 00 00 00    ................
0184D0:  00 43 08 04 00 00 00 00 00 00 00 00 03 0F 08 00    .C..............
0184E0:  00 00 03 3B 33 FF FF FF 88 FF 03 08 00 00 00 00    ...;3...........
0184F0:  00 00 00 00 00 EE 00 22 0A 88 00 EE 00 00 00 00    ......."........
018500:  00 00 15 FF CC 00 67 7F 11 CD 00 00 00 00 00 00    ......g.........
018510:  01 08 00 00 04 00 00 10 81 0A 00 00 00 00 00 00    ................
018520:  00 00 01 0E 0E 0F 03 07 0E 03 0F 0E 00 00 00 00    ................
018530:  00 00 06 FF DD FF 9A 3B FF DD EE 0C 00 00 00 00    .......;........
018540:  00 33 FF FF FF EE 0E 07 0F 0F 45 0F 0F 44 00 00    .3........E..D..
018550:  00 00 00 15 0F 0F 3B CC 0F 00 00 00 00 00 00 00    ......;.........
018560:  00 00 00 14 C0 D2 78 F0 B0 90 82 00 00 00 00 00    ......x.........
018570:  00 00 E0 03 07 0B 0E 00 01 0F 0F 0F 00 00 00 00    ................
018580:  00 00 01 1D FF FF DD FF FF FF 07 00 00 00 00 00    ................
018590:  8B 0F 0F 09 0F 00 03 0A 0A 0B 01 0D 0F 2A 00 00    .............*..
0185A0:  00 00 00 3B CD 0F 3B FF FF FF FF 04 00 00 00 00    ...;..;.........
0185B0:  00 00 00 05 38 F0 F0 F0 86 E0 01 00 00 00 00 01    ....8...........
0185C0:  09 0D 0F 0F 0F 06 0F 0C 00 0D 0F 08 00 00 00 00    ................
0185D0:  00 00 00 03 00 0F 0F 0F 0E 01 08 00 00 00 00 45    ...............E
0185E0:  0F 0F 0F 0E 88 00 00 00 00 00 11 07 1D 00 00 00    ................
0185F0:  00 00 00 00 02 FF BB FF 77 FF FF FF 99 FF 04 00    ........w.......
018600:  00 00 00 00 0F 0F 0F 0F 08 03 0F 0F 0F 0F 00 00    ................
018610:  22 00 00 00 00 00 00 00 00 00 00 00 00 00 00 11    "...............
018620:  EE 44 00 00 00 00 00 00 00 00 00 00 00 00 00 00    .D..............
018630:  00 00 11 44 00 CC 00 00 00 00 00 00 00 00 00 00    ...D............
018640:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018650:  00 00 00 00 00 00 01 0F 0F 0F 0F 08 00 00 00 00    ................
018660:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018670:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018680:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018690:  00 10 F0 E0 03 0E 00 00 0F 10 F0 68 00 00 00 00    ...........h....
0186A0:  00 00 00 00 00 00 00 22 00 88 00 00 00 00 00 00    ......."........
0186B0:  00 00 0B 1D FF 99 FF 88 CD 0F 04 00 00 00 00 00    ................
0186C0:  00 00 01 0A 00 05 05 00 00 00 00 00 00 00 00 00    ................
0186D0:  00 21 0C 08 00 00 00 00 00 00 00 00 00 0F 00 00    .!..............
0186E0:  00 00 01 08 FF FF BB 11 CC FF 8B 00 00 00 00 00    ................
0186F0:  00 00 00 00 33 11 88 45 0F 44 33 11 88 00 00 00    ....3..E.D3.....
018700:  00 00 15 FF FF FF DE B7 FF CD 00 00 00 00 00 00    ................
018710:  00 00 00 00 03 08 00 00 06 06 00 00 00 00 00 00    ................
018720:  00 00 03 0E 06 03 0F 0B 08 00 0F 0F 00 00 00 00    ................
018730:  00 00 06 11 99 FF B8 B3 FF BB 00 0C 00 00 00 00    ................
018740:  00 00 00 00 00 11 03 0F 0F 0E CD 0F 0F 44 00 00    .............D..
018750:  00 00 00 02 0C 00 00 03 08 00 00 00 00 00 00 00    ................
018760:  00 00 00 14 F0 E1 F0 80 70 F0 0A 00 00 00 00 00    ........p.......
018770:  00 00 81 07 07 0B 0E 00 01 0F 0C 03 08 00 00 00    ................
018780:  00 00 01 19 FF FF EE FF FF FF 8B 00 00 00 00 00    ................
018790:  8A 0F 0F 09 0F 0E 01 0A 0A 0B 09 0E 0F 2A 00 00    .............*..
0187A0:  00 00 01 77 8B 0F 1D FF FF FF EE 08 00 00 00 00    ...w............
0187B0:  00 00 00 05 70 F0 F0 F0 5A F0 03 00 00 00 00 00    ....p...Z.......
0187C0:  0F 03 0F 0F 0F 08 0F 0B 0E 01 0F 0C 00 00 00 00    ................
0187D0:  00 00 00 06 03 0E 00 00 0F 08 0C 00 00 00 00 22    ..............."
0187E0:  0F 0F 0F 0E 88 00 00 00 00 00 22 0F 0E 88 00 00    ..........".....
0187F0:  00 00 00 00 15 EE 33 FF 77 FF FF FF EE FF 04 00    ......3.w.......
018800:  00 00 00 01 04 00 0A 07 0E 00 00 00 00 10 20 03    .............. .
018810:  07 0F 06 0F 03 0F 0E 0C 07 0C 03 06 00 00 00 00    ................
018820:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018830:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018840:  00 00 00 00 01 0E 00 08 00 00 00 00 00 00 00 00    ................
018850:  00 00 00 00 00 00 0A 00 00 00 00 00 00 00 00 00    ................
018860:  00 00 00 00 00 00 00 00 00 00 0F 08 00 00 00 00    ................
018870:  00 00 00 00 00 00 00 00 00 00 00 30 20 00 00 00    ...........0 ...
018880:  90 00 00 00 00 00 00 00 03 0F 1D CD 03 08 00 00    ................
018890:  00 00 00 00 00 00 00 10 FD F6 00 00 00 00 00 00    ................
0188A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0188B0:  00 00 00 00 00 00 00 00 00 0F 0F 0F 08 00 00 00    ................
0188C0:  00 00 00 00 99 BB BB FF FF AA 00 00 01 0B 0F 0E    ................
0188D0:  00 00 00 0F 0F 0E EE 07 0F 09 0F 0F 0F 0E 00 00    ................
0188E0:  00 00 00 00 00 00 31 FF EC 00 10 77 1F DD 74 10    ......1....w..t.
0188F0:  40 00 10 40 71 55 CF 7F 40 00 00 00 00 00 25 81    @..@qU..@.....%.
018900:  05 05 05 00 01 1E C0 00 00 00 00 00 00 00 00 00    ................
018910:  00 00 22 BB 88 EE FF FF FF FF DD 00 07 05 02 00    ..".............
018920:  00 00 05 05 05 05 07 0F 09 0A 0E 0F 0F 0E 00 00    ................
018930:  31 FF FD B1 FC F0 F0 E4 00 00 00 31 25 FF EF 5B    1..........1%..[
018940:  DD 00 55 DE 3F FF AD 64 00 00 F5 F7 F5 FD 43 3C    ..U.?..d......C<
018950:  85 A5 A5 A5 A5 A5 87 2C 25 A4 F5 F5 F1 EA 88 00    .......,%.......
018960:  00 00 00 BB AA EE FF 8B 0E 0E 0B 0F 05 05 00 00    ................
018970:  00 00 05 05 05 05 07 0F 0B 03 0F 0F 0E 00 00 00    ................
018980:  00 73 FF FF FF FC F0 80 00 00 00 10 56 3F FF FF    .s..........V?..
018990:  DF 00 57 FF FF EF 5B 40 00 22 99 EE 99 AA FE FE    ..W...[@."......
0189A0:  F0 F0 C0 00 00 00 10 E0 F0 B2 DD 55 FF FF 99 00    ...........U....
0189B0:  00 00 07 08 00 00 0E 00 00 00 00 00 00 00 00 00    ................
0189C0:  00 00 45 05 05 05 07 0F 0E 00 00 00 00 00 00 00    ..E.............
0189D0:  00 06 06 00 00 08 00 00 00 00 00 00 00 D5 55 55    ..............UU
0189E0:  40 20 10 55 55 55 80 00 00 00 00 00 AA 00 DC FA    @ .UUU..........
0189F0:  FE FA FA FA FA FB 55 55 55 FF FF 55 55 55 44 00    ......UUU..UUUD.
018A00:  00 00 00 00 0A 00 0B 08 01 0C 00 04 00 10 60 03    ..............`.
018A10:  0E 0F 0E 0F 0B 0F 0B 0C 0F 0E 02 0F 00 00 00 00    ................
018A20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018A30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018A40:  00 00 00 00 02 11 BB 04 03 0E 00 00 00 00 00 00    ................
018A50:  00 00 00 00 00 00 0A 00 00 00 00 00 00 00 00 00    ................
018A60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018A70:  00 00 00 00 00 00 00 00 00 00 00 10 E0 00 00 00    ................
018A80:  F0 00 00 00 00 00 00 00 00 0F 0E 03 0C 00 00 00    ................
018A90:  00 00 00 00 00 00 00 10 FF FA 00 00 00 00 00 00    ................
018AA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018AB0:  00 00 00 00 00 00 00 00 00 0F 0F 0F 08 00 00 00    ................
018AC0:  00 00 00 00 AA DD FF FF FF AA 00 00 00 0F 0F 0E    ................
018AD0:  00 00 00 01 0F 0F 01 08 0F 0E 03 0F 0F 0E 00 00    ................
018AE0:  00 00 00 00 00 00 10 FF FE 00 10 BB EE AA C0 20    ............... 
018AF0:  80 00 00 A0 10 A2 BB EE C8 00 00 00 00 00 96 0E    ................
018B00:  00 00 00 07 1E F0 00 00 00 00 00 00 00 00 00 00    ................
018B10:  00 00 22 BB BB EE 33 FF FF FF AA 00 07 02 0A 00    .."...3.........
018B20:  00 00 02 0A 08 1B 47 0F 0E 07 02 0F 0F 0E 00 00    ......G.........
018B30:  73 FF FF D8 FB FF FF EC 00 00 00 62 9F BB 8F 3F    s..........b...?
018B40:  BA 80 E2 EF 0F EE CF BA 00 00 FB FA FA FA 87 C3    ................
018B50:  80 00 5A 5A 5A 4B 1E 4A 5A A4 FA D8 F4 C4 44 00    ..ZZZK.JZ.....D.
018B60:  00 00 00 88 11 DD 77 CD 0F 0F 0F 0F 02 09 00 00    ......w.........
018B70:  00 00 02 0A 08 0A 07 0F 0B 0C 0F 0F 0F 08 00 00    ................
018B80:  00 73 FF FF FE F3 FF E8 00 00 00 00 A3 19 FF BB    .s..........£...
018B90:  DD 00 55 EE FF CC 2E 80 00 22 11 22 66 66 D5 B8    ..U......"."ff..
018BA0:  F0 80 03 0F 0F 0F 0E 00 F0 73 AA EE AA FD 22 00    .........s....".
018BB0:  00 03 08 07 0F 0F 01 0F 08 00 0F 08 00 00 00 00    ................
018BC0:  00 00 02 0A 08 0A 07 0F 0F 08 00 00 00 00 00 00    ................
018BD0:  00 08 01 08 00 04 00 00 00 00 00 00 30 AA ED 2E    ............0...
018BE0:  A8 50 20 AB 3D AA E8 00 00 00 00 22 11 77 F5 FD    .P .=......".w..
018BF0:  FF FF F5 F7 F5 FD EE AA EE BB EE FF FF FF 00 00    ................
018C00:  01 00 0C 06 01 0E 08 03 0D 00 09 00 0B 0B 08 08    ................
018C10:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018C20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018C30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018C40:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018C50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018C60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018C70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018C80:  00 2D 47 57 2D 55 4B 20 20 42 41 53 00 00 00 06    .-GW-UK  BAS....
018C90:  4B 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    K...............
018CA0:  00 47 57 2D 46 52 20 20 20 44 4F 43 01 00 00 19    .GW-FR   DOC....
018CB0:  80 81 82 A1 00 00 00 00 00 00 00 00 00 00 00 00    ................
018CC0:  00 47 57 2D 55 4B 20 20 20 44 4F 43 00 00 00 7A    .GW-UK   DOC...z
018CD0:  83 84 87 88 89 8A 8B 8C 8D 8E 8F 90 91 92 93 94    ................
018CE0:  00 2D 47 57 44 45 4D 4F 20 42 41 53 00 00 00 02    .-GWDEMO BAS....
018CF0:  95 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018D00:  00 47 57 44 45 4D 4F 20 20 42 49 4E 00 00 00 46    .GWDEMO  BIN...F
018D10:  96 97 98 99 9A 9B 9C 9D 9E 00 00 00 00 00 00 00    ................
018D20:  00 49 4E 54 52 4F 20 20 20 44 41 54 00 00 00 0D    .INTRO   DAT....
018D30:  9F A0 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018D40:  00 4C 49 4E 45 4F 55 54 20 46 4E 54 00 00 00 07    .LINEOUT FNT....
018D50:  4F 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    O...............
018D60:  00 47 57 2D 43 4C 49 50 20 24 24 24 00 00 00 80    .GW-CLIP $$$....
018D70:  A3 A4 A5 A6 A7 A8 A9 AA AB AC AD AE AF B0 B1 B2    £...............
018D80:  00 41 43 43 45 4E 54 53 20 44 41 54 00 00 00 02    .ACCENTS DAT....
018D90:  A2 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018DA0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
018DB0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
018DC0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
018DD0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
018DE0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
018DF0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
018E00:  01 01 06 09 01 02 08 02 05 00 09 00 08 08 08 08    ................
018E10:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018E20:  00 00 00 06 00 00 00 00 00 00 00 00 00 00 00 00    ................
018E30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018E40:  00 00 00 00 00 00 00 00 00 44 00 00 00 00 00 00    .........D......
018E50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018E60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018E70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
018E80:  00 00 00 00 00 00 33 FF 00 00 00 00 00 00 00 00    ......3.........
018E90:  00 00 00 00 00 00 00 10 F0 F0 00 00 00 00 00 00    ................
018EA0:  00 00 00 02 13 FF FF CF 00 17 8C 00 03 00 00 00    ................
018EB0:  00 00 44 00 00 00 FF FF 00 00 00 00 00 00 00 00    ..D.............
018EC0:  00 00 01 2D A5 41 F0 C0 00 00 00 00 00 00 00 00    ...-.A..........
018ED0:  00 00 00 77 BB FF 07 22 0E FF 77 FF 00 00 00 00    ...w..."..w.....
018EE0:  00 00 00 70 F0 F0 D0 B0 F0 D0 F0 C0 00 00 00 00    ...p............
018EF0:  02 00 00 00 00 00 00 00 00 00 00 00 02 03 04 00    ................
018F00:  00 00 00 FF FF CD 0F 09 0F 77 FF CC 00 00 00 00    .........w......
018F10:  01 1A 12 B3 00 CC 22 F0 C0 C0 00 00 00 00 00 00    ......".........
018F20:  00 00 11 77 77 FF 04 00 00 00 FF EE 00 00 00 00    ...ww...........
018F30:  00 30 F0 F0 F0 F0 F0 90 C0 05 60 D0 B0 F0 00 00    .0........`.....
018F40:  02 01 08 00 00 00 13 08 00 00 00 00 00 02 00 00    ................
018F50:  00 00 77 FF FF EE 08 11 FF FF FF FF 00 00 00 00    ..w.............
018F60:  1E 38 B0 D0 F0 F0 F0 B0 B0 30 80 00 00 00 00 00    .8.......0......
018F70:  00 00 33 FF FF 06 77 FF FF 89 77 FF 00 00 00 00    ..3...w...w.....
018F80:  20 F0 F0 F0 F0 F0 80 00 30 F0 F0 E0 A0 A0 80 00     .......0.......
018F90:  00 00 33 FF 08 7F FF FF FF 09 FF EE 00 00 00 00    ..3.............
018FA0:  00 00 11 FF FF 07 33 FF 88 1D FF 44 00 00 00 00    ......3....D....
018FB0:  07 4A 82 E0 F0 F0 30 E0 38 70 00 00 00 00 00 00    .J....0.8p......
018FC0:  00 00 00 11 BB FF FF FF FF FF BB FF 88 00 00 00    ................
018FD0:  00 30 F0 F0 F0 F0 F0 91 FF B8 F0 10 B0 00 00 00    .0..............
018FE0:  00 00 00 00 46 13 FF FF 8C 7F 00 00 00 00 00 00    ....F...........
018FF0:  00 00 00 33 FF FF FF FF FF FF FF FF 00 00 00 00    ...3............
019000:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
019010:  15 00 01 00 02 09 4E E5 15 00 C1 02 00 00 00 02    ......N.........
019020:  15 00 C6 02 00 00 00 02 15 00 C2 02 00 00 00 02    ................
019030:  15 00 C7 02 00 00 00 02 15 00 C3 02 00 00 00 02    ................
019040:  15 00 C8 02 00 00 00 02 15 00 C4 02 00 00 00 02    ................
019050:  15 00 C9 02 00 00 00 02 15 00 C5 02 00 00 00 02    ................
019060:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
019070:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
019080:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
019090:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0190A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0190B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0190C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0190D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0190E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0190F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
019100:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
019110:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
019120:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
019130:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
019140:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
019150:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
019160:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
019170:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
019180:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
019190:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0191A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0191B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0191C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0191D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0191E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0191F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
019200:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
019210:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
019220:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
019230:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
019240:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
019250:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
019260:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
019270:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
019280:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
019290:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0192A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0192B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0192C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0192D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0192E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0192F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
019300:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
019310:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
019320:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
019330:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
019340:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
019350:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
019360:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
019370:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
019380:  C3 31 88 C3 ED 8D C3 A9 88 C3 BB 88 C3 95 8A C3    .1..............
019390:  DE 88 07 3F 20 20 20 20 20 20 20 20 2E 47 57 54    ...?        .GWT
0193A0:  00 00 20 21 22 25 28 29 2A 2E 3C 3E 3F 5B 5D 7B    .. !"%()*.<>?[]{
0193B0:  7D 3A 00 A7 F5 21 FF AB 11 40 00 0E 07 CD CE BC    }:...!...@......
0193C0:  F1 32 00 A7 CD 1C 89 3E 02 CD 0E BC 01 00 00 AF    .2.....>........
0193D0:  CD 32 BC 01 1A 1A 3E 01 CD 32 BC 01 00 00 CD 38    .2....>..2.....8
0193E0:  BC CD 58 92 CD 0D 92 CD 78 88 CD ED 8D 3E FF 32    ..X.....x....>.2
0193F0:  03 80 CD 49 92 C3 95 8A 21 69 89 CD A9 88 21 8F    ...I....!i....!.
019400:  89 CD A9 88 21 C6 89 CD A9 88 21 F8 89 CD A9 88    ....!.....!.....
019410:  21 4B 8A CD A9 88 21 65 8A CD A9 88 21 75 8A CD    !K....!e....!u..
019420:  A9 88 21 85 8A CD A9 88 C9 5E 23 56 23 EB CD 75    ..!......^#V#..u
019430:  BB EB 7E A7 C8 CD 5A BB 23 18 F7 21 05 00 11 18    ..~...Z.#..!....
019440:  4F CD 66 BB CD 6C BB 21 00 00 11 18 4F CD 66 BB    O.f..l.!....O.f.
019450:  C9 21 05 00 11 18 4F CD 66 BB CD 6C BB C9 21 F4    .!....O.f..l..!.
019460:  11 11 F5 11 01 5B 4E 36 20 ED B0 3E 01 32 0A 80    .....[N6 ..>.2..
019470:  32 09 80 32 08 80 CD ED 8D 21 58 8A 11 59 8A 01    2..2.....!X..Y..
019480:  0B 00 36 20 ED B0 21 14 88 11 15 88 01 07 00 36    ..6 ..!........6
019490:  20 ED B0 CD 49 92 3E FF 32 03 80 C9 21 2F 89 CD     ...I.>.2...!/..
0194A0:  D4 BC 22 30 89 79 32 32 89 3E FF DF 30 89 C9 81    .."0.y22.>..0...
0194B0:  00 00 00 CD D1 88 21 58 89 CD D4 BC 22 66 89 79    ......!X...."f.y
0194C0:  32 68 89 3E 01 DD 21 5C 89 DF 66 89 21 00 00 11    2h.>..!\..f.!...
0194D0:  18 4F CD 66 BB C3 95 8A 44 49 D2 00 5E 89 05 61    .O.f....DI..^..a
0194E0:  89 2A 2E 47 57 54 00 00 00 01 01 47 68 6F 75 6C    .*.GWT.....Ghoul
0194F0:  27 73 20 57 72 69 74 65 72 20 65 64 69 74 6F 72    's Writer editor
019500:  00 47 57 45 44 49 54 20 20 42 49 4E 00 00 00 00    .GWEDIT  BIN....
019510:  00 00 02 00 00 00 80 00 00 18 00 88 00 00 00 00    ................
019520:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
019530:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
019540:  00 18 00 17 04 00 00 47 57 45 44 49 54 20 20 24    .......GWEDIT  $
019550:  24 24 FF 00 FF 6F 72 2E 2E 2E 00 07 01 45 72 72    $$...or......Err
019560:  6F 72 2E 2E 2E 20 20 46 69 6C 65 20 68 61 73 20    or...  File has 
019570:  6E 6F 20 6E 61 6D 65 2E 2E 2E 00 1A 65 2E 2E 2E    no name.....e...
019580:  C3 4D 80 00 00 00 F4 11 01 01 01 0F 00 12 0A 3A    .M.............:
019590:  0A 80 FE 01 20 06 21 F4 11 22 06 80 3A 03 80 A7    .... .!.."..:...
0195A0:  28 0C 3E 1E 32 0B 80 3E 25 32 0C 80 18 09 3E 0F    (.>.2..>%2....>.
0195B0:  32 0B 80 3E 4A 18 F2 21 00 00 4F 06 00 3A 0D 80    2..>J..!..O..:..
0195C0:  09 3D 20 FC 7D 32 04 80 7C 32 05 80 C9 CD 0F 80    .= .}2..|2......
0195D0:  CD CB 82 CD 03 88 CD 1B BB D2 C9 80 FE FC C8 FE    ................
0195E0:  7F CA E0 81 FE 10 CA 12 82 FE E0 CA A9 83 FE F5    ................
0195F0:  CA 54 82 FE F4 CA 9A 82 FE 0D CA F2 82 FE 8B CA    .T..............
019600:  F2 82 FE FA CA DF 83 FE FB CA 07 84 FE F0 CA 23    ...............#
019610:  83 FE F1 CA 38 83 FE F2 CA 49 83 FE F3 CA 6B 83    ....8....I....k.
019620:  FE F7 CA 32 84 FE F6 CA 24 84 FE 09 CA 8B 83 4F    ...2....$......O
019630:  D6 8B CB 7F 28 9D 79 D6 20 38 98 CD D4 80 71 79    ....(.y. 8....qy
019640:  CD FC 80 CD 23 81 CD BA 81 CD FC 80 3E 7F CD 23    ....#.......>..#
019650:  81 C3 53 80 F5 C5 2A 06 80 3A 03 80 A7 28 05 01    ..S...*..:...(..
019660:  25 00 18 03 01 4A 00 3A 09 80 3D A7 28 04 09 3D    %....J.:..=.(..=
019670:  20 FC 47 3A 08 80 3D 4F 09 C1 F1 C9 F5 C5 21 93     .G:..=O......!.
019680:  C1 01 50 00 3A 09 80 3D A7 28 04 09 3D 20 FC 3A    ..P.:..=.(..= .:
019690:  08 80 3D 4F 3A 03 80 A7 28 02 CB 21 79 06 00 09    ..=O:...(..!y...
0196A0:  C1 F1 C9 F5 C5 E5 D5 E5 D1 4F 3A 03 80 A7 20 33    .........O:... 3
0196B0:  79 21 00 98 D6 20 28 07 01 08 00 09 3D 20 FC 01    y!... (.....= ..
0196C0:  00 08 EB 1A 77 13 09 1A 77 13 09 1A 77 13 09 1A    ....w...w...w...
0196D0:  77 13 09 1A 77 13 09 1A 77 13 09 1A 77 13 09 1A    w...w...w...w...
0196E0:  77 18 51 79 21 58 9B D6 20 28 07 01 10 00 09 3D    w.Qy!X.. (.....=
0196F0:  20 FC EB 01 FF 07 1A 77 23 13 1A 77 09 13 1A 77     ......w#..w...w
019700:  20 20 47 50 41 20 28 63 29 20 31 39 39 34 00 03      GPA (c) 1994..
019710:  01 28 4F 29 70 65 6E 20 20 28 53 29 61 76 65 20    .(O)pen  (S)ave 
019720:  20 28 4E 29 65 77 20 74 65 78 74 20 20 28 45 29     (N)ew text  (E)
019730:  64 69 74 20 20 28 54 29 61 62 20 20 28 43 29 6F    dit  (T)ab  (C)o
019740:  6E 76 65 72 74 00 04 01 28 48 29 65 6C 70 20 20    nvert...(H)elp  
019750:  28 44 29 69 72 20 20 20 28 46 29 69 6C 65 6E 61    (D)ir   (F)ilena
019760:  6D 65 20 20 28 49 29 6E 66 6F 20 20 28 41 29 3A    me  (I)nfo  (A):
019770:  20 20 20 28 42 29 3A 00 05 01 9A 9A 9A 9A 9A 9A       (B):.........
019780:  9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A    ................
019790:  9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A    ................
0197A0:  9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A    ................
0197B0:  9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A    ................
0197C0:  9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 00 01 3A 46 69 6C    ............:Fil
0197D0:  65 20 20 20 3A 20 20 3A 20 20 20 20 20 20 20 20    e   :  :        
0197E0:  20 20 20 20 00 02 3A 50 61 67 65 20 20 20 3A 00        ..:Page   :.
0197F0:  02 43 30 31 00 03 3A 4C 69 6E 65 20 20 20 3A 00    .C01..:Line   :.
019800:  03 43 30 31 00 04 3A 43 6F 6C 75 6D 6E 20 3A 00    .C01..:Column :.
019810:  04 43 30 31 00 CD 18 BB E6 DF FE 49 CA D9 8A FE    .C01.......I....
019820:  48 CA F1 8A FE 44 CA 33 89 FE 54 CA 95 8D FE 4F    H....D.3..T....O
019830:  CA 57 8E FE 45 CA B9 8F FE 4E CA F6 8F FE 53 CA    .W..E....N....S.
019840:  D8 90 FE 46 CA B5 90 FE 43 CA 00 95 FE 41 CA 34    ...F....C....A.4
019850:  92 FE 42 CA 3E 92 C3 95 8A CD BB 88 21 28 8B CD    ..B.>.......!(..
019860:  A9 88 21 45 8B CD A9 88 21 64 8B CD A9 88 C3 95    ..!E....!d......
019870:  8A CD BB 88 11 0C 8B 3E 0E EB 5E 23 56 23 EB D5    .......>..^#V#..
019880:  F5 CD A9 88 F1 D1 3D 20 F0 C3 95 8A 83 8B 97 8B    ......= ........
019890:  BD 8B EC 8B 1B 8C 4B 8C 7B 8C A9 8C C7 8C E5 8C    ......K.{.......
0198A0:  05 8D 21 8D 43 8D 64 8D 0B 1B 47 68 6F 75 6C 27    ..!.C.d...Ghoul'
0198B0:  73 20 57 72 69 74 65 72 20 65 64 69 74 6F 72 20    s Writer editor 
0198C0:  76 31 2E 30 00 0D 1A 43 6F 64 65 64 20 62 79 20    v1.0...Coded by 
0198D0:  54 6F 6D 20 65 74 20 4A 65 72 72 79 20 6F 66 20    Tom et Jerry of 
0198E0:  47 50 41 00 0F 1A 54 68 69 73 20 70 72 6F 67 72    GPA...This progr
0198F0:  61 6D 20 69 73 20 73 68 61 72 65 77 61 72 65 20    am is shareware 
019900:  23 13 1A 77 09 13 1A 77 23 13 1A 77 09 13 1A 77    #..w...w#..w...w
019910:  23 13 1A 77 09 13 1A 77 23 13 1A 77 09 13 1A 77    #..w...w#..w...w
019920:  23 13 1A 77 09 13 1A 77 23 13 1A 77 09 13 1A 77    #..w...w#..w...w
019930:  23 13 1A 77 EB D1 E1 C1 F1 C9 21 0C 80 3A 08 80    #..w......!..:..
019940:  BE 28 05 3C 32 08 80 C9 3A 09 80 FE 12 28 0A 3C    .(.<2...:....(.<
019950:  32 09 80 3E 01 32 08 80 C9 CD 0D 84 3E 01 18 F0    2..>.2......>...
019960:  3A 08 80 FE 01 CA 53 80 4F 3A 0C 80 91 3C 4F 06    :.....S.O:...<O.
019970:  00 C5 CD D4 80 E5 D1 1B D5 ED B0 3E 20 12 3A 08    ...........> .:.
019980:  80 3D 32 08 80 D1 C1 41 04 CD FC 80 CD 3B 82 C3    .=2....A.....;..
019990:  53 80 3A 08 80 4F 3A 0C 80 B9 CA 53 80 91 4F 06    S.:..O:....S..O.
0199A0:  00 C5 CD D4 80 E5 D1 23 D5 ED B0 3E 20 12 D1 C1    .......#...> ...
0199B0:  41 04 CD FC 80 CD 3B 82 C3 53 80 3A 03 80 A7 20    A.....;..S.:... 
0199C0:  09 1A CD 23 81 13 23 10 F8 C9 1A CD 23 81 13 23    ...#..#.....#..#
0199D0:  23 10 F7 C9 3A 08 80 4F 3E 01 32 08 80 CD D4 80    #...:..O>.2.....
0199E0:  E5 79 32 08 80 3A 0C 80 5F 16 60 01 00 60 79 95    .y2..:.._.`..`y.
0199F0:  30 01 05 4F 78 94 47 03 21 00 60 ED B8 E1 3A 0C    0..Ox.G.!.`...:.
019A00:  80 36 20 23 3D 20 FA 21 00 60 11 01 60 01 7F 00    .6 #= .!.`..`...
019A10:  36 20 ED B0 CD CB 82 C3 53 80 3A 08 80 4F 3E 01    6 ......S.:..O>.
019A20:  32 08 80 CD D4 80 79 32 08 80 E5 01 00 60 79 95    2.....y2.....`y.
019A30:  30 01 05 4F 78 94 47 E1 54 5D C5 3A 0C 80 4F 06    0..Ox.G.T].:..O.
019A40:  00 09 C1 ED B0 CD CB 82 C3 53 80 2A 08 80 E5 21    .........S.*...!
019A50:  01 01 06 12 C5 22 08 80 E5 CD D4 80 54 5D CD FC    ....."......T]..
019A60:  80 3A 0C 80 47 CD 3B 82 E1 24 C1 10 E7 E1 22 08    .:..G.;..$....".
019A70:  80 C9 CD 0F 83 3E 01 32 08 80 3A 09 80 FE 12 28    .....>.2..:....(
019A80:  03 3C 18 05 CD 0D 84 3E 01 32 09 80 C3 53 80 CD    .<.....>.2...S..
019A90:  D4 80 7E CD FC 80 CD 23 81 C9 CD FC 80 3E 7F CD    ..~....#.....>..
019AA0:  23 81 C9 CD 0F 83 3A 09 80 3D A7 20 02 3E 12 32    #.....:..=. .>.2
019AB0:  09 80 CD 1A 83 C3 53 80 CD 0F 83 3A 09 80 FE 12    ......S....:....
019AC0:  28 03 3C 18 EA 3E 01 18 E6 CD 0F 83 3A 08 80 3D    (.<..>......:..=
019AD0:  A7 20 0F 3A 09 80 3D A7 20 02 3E 12 32 09 80 3A    . .:..=. .>.2..:
019AE0:  0C 80 32 08 80 CD 1A 83 C3 53 80 CD 0F 83 3A 08    ..2......S....:.
019AF0:  80 21 0C 80 BE 20 11 3A 09 80 FE 12 28 03 3C 18    .!... .:....(.<.
019B00:  21 21 00 07 01 45 64 69 74 6F 72 20 6B 65 79 73    !!...Editor keys
019B10:  20 61 72 65 20 3A 00 09 13 43 75 72 73 6F 72 20     are :...Cursor 
019B20:  6B 65 79 73 20 20 20 2D 20 4D 6F 76 65 20 63 75    keys   - Move cu
019B30:  72 73 6F 72 20 6F 6E 20 70 61 67 65 00 0A 13 43    rsor on page...C
019B40:  6F 70 79 20 20 20 20 20 20 20 20 20 20 2D 20 49    opy          - I
019B50:  6E 73 65 72 74 20 63 68 61 72 61 63 74 65 72 20    nsert character 
019B60:  28 6F 6E 20 61 20 6C 69 6E 65 29 00 0B 13 44 65    (on a line)...De
019B70:  6C 20 26 20 43 6C 72 20 20 20 20 20 2D 20 44 65    l & Clr     - De
019B80:  6C 65 74 65 20 63 68 61 72 61 63 74 65 72 20 28    lete character (
019B90:  6F 6E 20 61 20 6C 69 6E 65 29 00 0C 13 53 68 69    on a line)...Shi
019BA0:  66 74 20 2B 20 6C 65 66 74 20 20 2D 20 44 65 6C    ft + left  - Del
019BB0:  65 74 65 20 63 68 61 72 61 63 74 65 72 20 28 77    ete character (w
019BC0:  68 6F 6C 65 20 74 65 78 74 29 00 0D 13 53 68 69    hole text)...Shi
019BD0:  66 74 20 2B 20 72 69 67 68 74 20 2D 20 49 6E 73    ft + right - Ins
019BE0:  65 72 74 20 63 68 61 72 61 63 74 65 72 20 28 77    ert character (w
019BF0:  68 6F 6C 65 20 74 65 78 74 29 00 0E 13 54 61 62    hole text)...Tab
019C00:  20 20 20 20 20 20 20 20 20 20 20 2D 20 4D 6F 76               - Mov
019C10:  65 20 63 75 72 73 6F 72 20 6F 66 20 78 20 63 68    e cursor of x ch
019C20:  61 72 61 63 74 65 72 73 00 0F 13 53 68 69 66 74    aracters...Shift
019C30:  20 2B 20 75 70 20 20 20 20 2D 20 44 65 6C 65 74     + up    - Delet
019C40:  65 20 6C 69 6E 65 00 10 13 53 68 69 66 74 20 2B    e line...Shift +
019C50:  20 64 6F 77 6E 20 20 2D 20 49 6E 73 65 72 74 20     down  - Insert 
019C60:  6C 69 6E 65 00 11 13 43 74 72 6C 20 2B 20 6C 65    line...Ctrl + le
019C70:  66 74 20 20 20 2D 20 50 72 65 76 69 6F 75 73 20    ft   - Previous 
019C80:  70 61 67 65 00 12 13 43 74 72 6C 20 2B 20 72 69    page...Ctrl + ri
019C90:  67 68 74 20 20 2D 20 4E 65 78 74 20 70 61 67 65    ght  - Next page
019CA0:  00 13 13 52 65 74 75 72 6E 20 20 20 20 20 20 20    ...Return       
019CB0:  20 2D 20 47 6F 20 74 6F 20 6E 65 78 74 20 6C 69     - Go to next li
019CC0:  6E 65 00 14 13 45 73 63 20 20 20 20 20 20 20 20    ne...Esc        
019CD0:  20 20 20 2D 20 52 65 74 75 72 6E 20 74 6F 20 6D       - Return to m
019CE0:  65 6E 75 00 16 11 46 6F 72 20 6D 6F 72 65 20 69    enu...For more i
019CF0:  6E 66 6F 72 6D 61 74 69 6F 6E 73 2C 20 72 65 61    nformations, rea
019D00:  02 3E 01 32 09 80 3E 00 3C 18 D7 CD 0F 83 3A 08    .>.2..>.<.....:.
019D10:  80 4F 3A 0E 80 81 4F 47 3A 0C 80 91 DA 53 80 78    .O:...OG:....S.x
019D20:  32 08 80 CD 1A 83 C3 53 80 3A 08 80 4F 3A 0C 80    2......S.:..O:..
019D30:  B9 20 0E CD D4 80 36 20 CD FC 80 CD 23 81 C3 53    . ....6 ....#..S
019D40:  80 91 3C CD D4 80 47 C5 1E 20 7E 73 5F 23 10 FA    ..<...G.. ~s_#..
019D50:  CD D4 80 5D 54 CD FC 80 C1 CD 3B 82 C3 53 80 CD    ...]T.....;..S..
019D60:  E5 83 C3 53 80 3A 0A 80 FE 01 C8 3D 32 0A 80 2A    ...S.:.....=2..*
019D70:  04 80 4D 44 2A 06 80 7D 91 30 01 25 6F 7C 90 67    ..MD*..}.0.%o|.g
019D80:  22 06 80 CD CB 82 C9 CD 0D 84 C3 53 80 3A 0A 80    "..........S.:..
019D90:  21 0B 80 BE C8 3C 32 0A 80 2A 04 80 4D 44 2A 06    !....<2..*..MD*.
019DA0:  80 09 18 DC CD 42 84 5D 54 23 ED B0 CD CB 82 C3    .....B.]T#......
019DB0:  53 80 CD 42 84 21 00 60 11 01 60 ED B8 3E 20 12    S..B.!.`..`..> .
019DC0:  18 EA CD D4 80 01 00 60 79 95 30 01 05 4F 78 94    .......`y.0..Ox.
019DD0:  47 03 C9 00 00 00 00 00 00 00 00 00 00 00 00 00    G...............
019DE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
019DF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
019E00:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
019E10:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
019E20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
019E30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
019E40:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
019E50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
019E60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
019E70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
019E80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
019E90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
019EA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
019EB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
019EC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
019ED0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
019EE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
019EF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
019F00:  64 20 74 68 65 20 66 69 6C 65 20 47 57 2D 55 4B    d the file GW-UK
019F10:  2E 44 4F 43 00 CD BB 88 21 1B 8E CD A9 88 21 52    .DOC....!.....!R
019F20:  8E CD A9 88 CD 18 BB FE FC C2 B2 8D CD BB 88 C3    ................
019F30:  95 8A FE F2 28 0E FE F3 20 EA 3A 0E 80 3C FE 28    ....(... .:..<.(
019F40:  28 E2 18 07 3A 0E 80 3D A7 28 D9 32 0E 80 21 54    (...:..=.(.2..!T
019F50:  8E CD DC 8D 21 52 8E CD A9 88 18 C8 0E FF 0C D6    ....!R..........
019F60:  0A 30 FB C6 3A 23 77 2B 79 C6 30 77 C9 3A 0A 80    .0..:#w+y.0w.:..
019F70:  21 72 8A CD DC 8D 21 70 8A CD A9 88 3A 09 80 21    !r....!p....:..!
019F80:  82 8A CD DC 8D 21 80 8A CD A9 88 3A 08 80 21 92    .....!.....:..!.
019F90:  8A CD DC 8D 21 90 8A CD A9 88 C9 07 01 43 68 61    ....!........Cha
019FA0:  6E 67 65 20 54 61 62 20 76 61 6C 75 65 20 77 69    nge Tab value wi
019FB0:  74 68 20 6C 65 66 74 20 61 6E 64 20 72 69 67 68    th left and righ
019FC0:  74 2C 20 28 45 73 63 29 20 74 6F 20 65 6E 64 20    t, (Esc) to end 
019FD0:  3A 00 07 36 31 30 00 CD BB 88 CD DE 88 21 D5 8E    :..610.......!..
019FE0:  CD A9 88 21 12 88 CD 45 8F FE FC 20 06 CD BB 88    ...!...E... ....
019FF0:  C3 95 8A 3A 5A BB 32 21 88 3E C9 32 5A BB 21 14    ...:Z.2!.>.2Z.!.
01A000:  88 06 0C 11 00 C0 CD 77 BC 30 33 21 F3 11 CD 83    .......w.03!....
01A010:  BC 30 2B CD 7A BC 30 26 3A 21 88 32 5A BB CD BB    .0+.z.0&:!.2Z...
01A020:  88 21 29 8F CD A9 88 21 14 88 11 58 8A 01 0C 00    .!)....!...X....
01A030:  ED B0 CD 49 92 3A F3 11 32 03 80 C3 95 8A CD 7D    ...I.:..2......}
01A040:  BC 3A 21 88 32 5A BB 21 14 88 36 20 21 16 8F CD    .:!.2Z.!..6 !...
01A050:  A9 88 C3 95 8A 07 01 54 79 70 65 20 66 69 6C 65    .......Type file
01A060:  6E 61 6D 65 20 74 6F 20 6C 6F 61 64 2C 20 28 52    name to load, (R
01A070:  65 74 75 72 6E 29 20 74 6F 20 76 61 6C 69 64 61    eturn) to valida
01A080:  74 65 2C 20 28 45 73 63 29 20 74 6F 20 61 62 6F    te, (Esc) to abo
01A090:  72 74 20 3A 20 00 09 01 4C 6F 61 64 69 6E 67 20    rt : ...Loading 
01A0A0:  65 72 72 6F 72 2E 2E 2E 00 07 01 46 69 6C 65 20    error......File 
01A0B0:  6C 6F 61 64 65 64 20 73 75 63 63 65 73 66 75 6C    loaded succesful
01A0C0:  6C 79 2E 00 01 21 14 88 11 15 88 01 07 00 36 20    ly...!........6 
01A0D0:  ED B0 3E 01 32 44 8F 21 12 88 CD A9 88 21 13 88    ..>.2D.!.....!..
01A0E0:  CD 18 BB FE FC C8 FE 0D C8 FE 8B C8 FE 7F 28 36    ..............(6
01A0F0:  5F 06 0F DD 21 22 88 DD 7E 00 BB 28 DA DD 23 10    _...!"..~..(..#.
01A100:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A110:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A120:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A130:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A140:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A150:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A160:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A170:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A180:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A190:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A1A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A1B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A1C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A1D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A1E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A1F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A200:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A210:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A220:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A230:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A240:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A250:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A260:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A270:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A280:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A290:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A2A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A2B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A2C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A2D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A2E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A2F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A300:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
01A310:  16 00 01 00 02 09 4E E5 16 00 C1 02 00 00 00 02    ......N.........
01A320:  16 00 C6 02 00 00 00 02 16 00 C2 02 00 00 00 02    ................
01A330:  16 00 C7 02 00 00 00 02 16 00 C3 02 00 00 00 02    ................
01A340:  16 00 C8 02 00 00 00 02 16 00 C4 02 00 00 00 02    ................
01A350:  16 00 C9 02 00 00 00 02 16 00 C5 02 00 00 00 02    ................
01A360:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A370:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A380:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A390:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A3A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A3B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A3C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A3D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A3E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A3F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A400:  F6 7B D6 7B 30 D1 7B D6 61 38 04 7B E6 DF 5F 7B    .{.{0.{.a8.{.._{
01A410:  D6 20 38 C3 3A 44 8F FE 09 28 BC 4F 3C 32 44 8F    . 8.:D...(.O<2D.
01A420:  06 00 09 73 18 B1 3A 44 8F FE 01 28 AA 3D 4F 06    ...s..:D...(.=O.
01A430:  00 09 36 20 32 44 8F 18 9E CD BB 88 3A 03 80 FE    ..6 2D......:...
01A440:  FF 20 09 21 D8 8F CD A9 88 C3 95 8A CD BB 88 CD    . .!............
01A450:  00 80 CD BB 88 C3 95 8A 07 01 45 72 72 6F 72 2C    ..........Error,
01A460:  20 6E 6F 20 74 65 78 74 20 69 6E 20 6D 65 6D 6F     no text in memo
01A470:  72 79 2E 2E 2E 00 CD BB 88 3A 03 80 FE FF 28 13    ry.......:....(.
01A480:  21 4F 90 CD A9 88 CD 18 BB F5 CD BB 88 F1 FE FC    !O..............
01A490:  CA 95 8A 21 87 90 CD A9 88 CD 18 BB FE 31 28 12    ...!.........1(.
01A4A0:  FE 32 28 25 FE 82 28 0A FE 83 28 1D CD BB 88 C3    .2(%..(...(.....
01A4B0:  95 8A CD DE 88 3E 01 32 03 80 32 F3 11 CD BB 88    .....>.2..2.....
01A4C0:  CD 00 80 CD BB 88 C3 95 8A CD DE 88 AF 18 E8 07    ................
01A4D0:  01 57 61 72 6E 69 6E 67 2C 20 79 6F 75 20 77 69    .Warning, you wi
01A4E0:  6C 6C 20 65 72 61 73 65 20 63 75 72 72 65 6E 74    ll erase current
01A4F0:  20 74 65 78 74 2C 20 28 45 73 63 29 20 74 6F 20     text, (Esc) to 
01A500:  61 62 6F 72 74 2E 00 07 01 54 65 78 74 6D 6F 64    abort....Textmod
01A510:  65 20 28 31 29 20 6F 72 20 28 32 29 20 3F 20 20    e (1) or (2) ?  
01A520:  61 6E 6F 74 68 65 72 20 6B 65 79 20 74 6F 20 61    another key to a
01A530:  62 6F 72 74 00 CD BB 88 21 57 91 CD A9 88 21 12    bort....!W....!.
01A540:  88 CD 45 8F 21 14 88 11 58 8A 01 0C 00 ED B0 CD    ..E.!...X.......
01A550:  BB 88 CD 49 92 C3 95 8A CD BB 88 3A 14 88 FE 20    ...I.......:... 
01A560:  20 0C CD BB 88 21 D9 91 CD A9 88 C3 95 8A CD F6     ....!..........
01A570:  91 FE FF 20 0C CD BB 88 21 C4 91 CD A9 88 C3 95    ... ....!.......
01A580:  8A 3A 5A BB 32 21 88 3E C9 32 5A BB 3A 03 80 32    .:Z.2!.>.2Z.:..2
01A590:  F3 11 E5 21 14 88 06 0C 11 00 C0 CD 8C BC 30 24    ...!..........0$
01A5A0:  21 F3 11 01 00 00 3E 02 D1 13 CD 98 BC 30 16 CD    !.....>......0..
01A5B0:  8F BC 3A 21 88 32 5A BB CD BB 88 21 AA 91 CD A9    ..:!.2Z....!....
01A5C0:  88 C3 95 8A E1 CD 92 BC 3A 21 88 32 5A BB 21 98    ........:!.2Z.!.
01A5D0:  91 CD A9 88 C3 95 8A 07 01 50 6C 65 61 73 65 20    .........Please 
01A5E0:  74 79 70 65 20 66 69 6C 65 6E 61 6D 65 2C 20 20    type filename,  
01A5F0:  28 52 65 74 75 72 6E 29 20 74 6F 20 76 61 6C 69    (Return) to vali
01A600:  20 20 47 50 41 20 28 63 29 20 31 39 39 34 00 03      GPA (c) 1994..
01A610:  01 28 4F 29 70 65 6E 20 20 28 53 29 61 76 65 20    .(O)pen  (S)ave 
01A620:  20 28 4E 29 65 77 20 74 65 78 74 20 20 28 45 29     (N)ew text  (E)
01A630:  64 69 74 20 20 28 54 29 61 62 20 20 28 43 29 6F    dit  (T)ab  (C)o
01A640:  6E 76 65 72 74 00 04 01 28 48 29 65 6C 70 20 20    nvert...(H)elp  
01A650:  28 44 29 69 72 20 20 20 28 46 29 69 6C 65 6E 61    (D)ir   (F)ilena
01A660:  6D 65 20 20 28 49 29 6E 66 6F 20 20 28 41 29 3A    me  (I)nfo  (A):
01A670:  20 20 20 28 42 29 3A 00 05 01 9A 9A 9A 9A 9A 9A       (B):.........
01A680:  9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A    ................
01A690:  9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A    ................
01A6A0:  9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A    ................
01A6B0:  9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A    ................
01A6C0:  9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 00 01 3A 46 69 6C    ............:Fil
01A6D0:  65 20 20 20 3A 20 20 3A 20 20 20 20 20 20 20 20    e   :  :        
01A6E0:  20 20 20 20 00 02 3A 50 61 67 65 20 20 20 3A 00        ..:Page   :.
01A6F0:  02 43 30 31 00 03 3A 4C 69 6E 65 20 20 20 3A 00    .C01..:Line   :.
01A700:  03 43 30 31 00 04 3A 43 6F 6C 75 6D 6E 20 3A 00    .C01..:Column :.
01A710:  04 43 30 31 00 CD 18 BB E6 DF FE 49 CA D9 8A FE    .C01.......I....
01A720:  48 CA F1 8A FE 44 CA 33 89 FE 54 CA 95 8D FE 4F    H....D.3..T....O
01A730:  CA 57 8E FE 45 CA B9 8F FE 4E CA F6 8F FE 53 CA    .W..E....N....S.
01A740:  D8 90 FE 46 CA B5 90 FE 43 CA 00 95 FE 41 CA 34    ...F....C....A.4
01A750:  92 FE 42 CA 3E 92 C3 95 8A CD BB 88 21 28 8B CD    ..B.>.......!(..
01A760:  A9 88 21 45 8B CD A9 88 21 64 8B CD A9 88 C3 95    ..!E....!d......
01A770:  8A CD BB 88 11 0C 8B 3E 0E EB 5E 23 56 23 EB D5    .......>..^#V#..
01A780:  F5 CD A9 88 F1 D1 3D 20 F0 C3 95 8A 83 8B 97 8B    ......= ........
01A790:  BD 8B EC 8B 1B 8C 4B 8C 7B 8C A9 8C C7 8C E5 8C    ......K.{.......
01A7A0:  05 8D 21 8D 43 8D 64 8D 0B 1B 47 68 6F 75 6C 27    ..!.C.d...Ghoul'
01A7B0:  73 20 57 72 69 74 65 72 20 65 64 69 74 6F 72 20    s Writer editor 
01A7C0:  76 31 2E 30 00 0D 1A 43 6F 64 65 64 20 62 79 20    v1.0...Coded by 
01A7D0:  54 6F 6D 20 65 74 20 4A 65 72 72 79 20 6F 66 20    Tom et Jerry of 
01A7E0:  47 50 41 00 0F 1A 54 68 69 73 20 70 72 6F 67 72    GPA...This progr
01A7F0:  61 6D 20 69 73 20 73 68 61 72 65 77 61 72 65 20    am is shareware 
01A800:  64 61 74 65 2C 20 28 45 73 63 29 20 74 6F 20 61    date, (Esc) to a
01A810:  62 6F 72 74 20 3A 20 00 07 01 53 61 76 69 6E 67    bort : ...Saving
01A820:  20 65 72 72 6F 72 2E 2E 2E 00 07 01 46 69 6C 65     error......File
01A830:  20 73 61 76 65 64 20 73 75 63 63 65 73 66 75 6C     saved succesful
01A840:  6C 79 2E 00 07 01 4E 6F 20 74 65 78 74 20 74 6F    ly....No text to
01A850:  20 73 61 76 65 2E 2E 2E 00 07 01 45 72 72 6F 72     save......Error
01A860:  2E 2E 2E 20 46 69 6C 65 20 68 61 73 20 6E 6F 20    ... File has no 
01A870:  6E 61 6D 65 2E 00 21 FF 5F 01 0B 4E 7E FE 20 20    name..!._..N~.  
01A880:  08 2B 0B 78 FE FF C8 18 F3 03 69 60 C9 21 1D 92    .+.x......i`.!..
01A890:  7E A7 C8 23 46 23 E5 CD 27 BB E1 18 F3 0F 81 0D    ~..#F#..'.......
01A8A0:  82 0E 83 05 84 14 85 0C 86 04 87 0A 88 0B 89 03    ................
01A8B0:  8A 07 2E 00 AF 32 00 A7 CD 49 92 C3 95 8A 3E 01    .....2...I....>.
01A8C0:  32 00 A7 CD 49 92 C3 95 8A 21 4B 8A 3A 00 A7 C6    2...I....!K.:...
01A8D0:  41 32 56 8A CD A9 88 C9 06 6B 21 00 98 11 58 9B    A2V......k!...X.
01A8E0:  C5 06 08 AF 4E CB 61 28 02 3E 03 CB 69 28 02 C6    ....N.a(.>..i(..
01A8F0:  0C CB 71 28 02 C6 30 CB 79 28 02 C6 C0 12 13 AF    ..q(..0.y(......
01A900:  CB 41 28 02 C6 03 CB 49 28 02 C6 0C CB 51 28 02    .A(....I(....Q(.
01A910:  C6 30 CB 59 28 02 C6 C0 12 13 23 10 C6 C1 10 C0    .0.Y(.....#.....
01A920:  C9 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A930:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A940:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A950:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A960:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A970:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A980:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A990:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A9A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A9B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A9C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A9D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A9E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01A9F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01AA00:  00 4C 45 47 45 4E 44 20 20 4D 55 53 00 00 00 00    .LEGEND  MUS....
01AA10:  00 00 02 00 00 00 60 00 A1 0F 00 60 00 00 00 00    ......`....`....
01AA20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01AA30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01AA40:  A1 0F 00 06 05 2F 82 23 82 2F 82 23 82 2F 82 22    ...../.#./.#./."
01AA50:  02 04 2E 82 22 82 2E 82 22 82 2E 82 22 82 2E 82    ...."..."..."...
01AA60:  FF 49 40 B2 0F FF 1A 00 00 00 00 00 00 00 00 00    .I@.............
01AA70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01AA80:  C3 0B 60 C3 93 60 C3 77 60 66 04 06 03 DD 21 DA    ..`..`.w`f....!.
01AA90:  63 FD 21 06 63 11 1C 00 C5 DD 36 06 01 DD 72 09    c.!.c.....6...r.
01AAA0:  DD 72 1B DD 36 05 10 FD 6E 00 FD 66 01 7E DD 77    .r..6...n..f.~.w
01AAB0:  08 23 4E 23 46 23 DD 75 0C DD 74 0D DD 71 00 DD    .#N#F#.u..t..q..
01AAC0:  70 01 DD 19 FD 23 FD 23 C1 10 CD 3E 06 32 BB 60    p....#.#...>.2.`
01AAD0:  7A 32 CF 60 3C 32 B6 60 3E 38 32 C0 60 3E FF 32    z2.`<2.`>82.`>.2
01AAE0:  02 63 32 03 63 32 04 63 32 05 63 3E 0C 4A CD E4    .c2.c2.c2.c>.J..
01AAF0:  62 3E 0D 4A C3 E4 62 3E 07 0E 3F CD E4 62 3E 08    b>.J..b>..?..b>.
01AB00:  0E 00 CD E4 62 3E 09 0E 00 CD E4 62 3E 0A 0E 00    ....b>.....b>...
01AB10:  C3 E4 62 21 B6 60 35 DD 21 DA 63 01 E8 63 CD 49    ..b!.`5.!.c..c.I
01AB20:  61 DD 21 F6 63 01 04 64 CD 49 61 DD 21 12 64 01    a.!.c..d.Ia.!.d.
01AB30:  20 64 CD 49 61 3E 00 B7 20 05 3E 00 32 B6 60 3E     d.Ia>.. .>.2.`>
01AB40:  00 21 03 63 BE 28 07 77 4F 3E 07 CD E4 62 3E 00    .!.c.(.wO>...b>.
01AB50:  21 02 63 BE 28 07 77 4F 3E 06 CD E4 62 3E 00 21    !.c.(.wO>...b>.!
01AB60:  04 63 BE 28 07 77 4F 3E 0B CD E4 62 3E 00 21 05    .c.(.wO>...b>.!.
01AB70:  63 BE C8 77 4F 3E 0D C3 E4 62 23 46 DD 70 06 23    c..wO>...b#F.p.#
01AB80:  DD 75 00 DD 74 01 C3 FA 61 23 7E DD 77 06 23 DD    .u..t...a#~.w.#.
01AB90:  75 00 DD 74 01 AF DD 77 17 DD 77 15 4F DD 7E 04    u..t...w..w.O.~.
01ABA0:  C3 E4 62 DD 36 0A 00 DD 6E 0C DD 66 0D 7E FE 80    ..b.6...n..f.~..
01ABB0:  20 06 23 5E 23 56 EB 7E 23 5E 23 56 23 DD 75 0C     .#^#V.~#^#V#.u.
01ABC0:  DD 74 0D DD 77 08 EB 18 13 3A B6 60 B7 C2 FA 61    .t..w....:.`...a
01ABD0:  DD 35 06 C2 FA 61 DD 6E 00 DD 66 01 7E B7 28 9A    .5...a.n..f.~.(.
01ABE0:  FE FE 28 A5 FE FF 28 BB 16 00 E6 7F D6 0A DD 86    ..(...(.........
01ABF0:  08 DD 77 07 87 5F E5 21 0C 63 19 7E DD 77 18 23    ..w.._.!.c.~.w.#
01AC00:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01AC10:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01AC20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01AC30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01AC40:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01AC50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01AC60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01AC70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01AC80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01AC90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01ACA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01ACB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01ACC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01ACD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01ACE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01ACF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01AD00:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01AD10:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01AD20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01AD30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01AD40:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01AD50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01AD60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01AD70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01AD80:  C3 09 95 F4 11 F4 11 00 00 CD B6 95 FE FF 20 06    .............. .
01AD90:  CD 09 88 C3 0C 88 CD 09 88 3A 14 88 FE 20 20 0F    .........:...  .
01ADA0:  21 16 97 CD 06 88 CD 18 BB CD 09 88 C3 0C 88 21    !..............!
01ADB0:  F4 11 22 05 95 22 03 95 3A 03 80 FE 01 28 04 3E    ..".."..:....(.>
01ADC0:  4A 18 02 3E 25 32 07 95 2A 03 95 7E A7 CA C9 95    J..>%2..*..~....
01ADD0:  CD 5C 95 22 03 95 CD 6A 95 C3 48 95 11 00 A3 3A    .\."...j..H...£:
01ADE0:  07 95 06 00 4F ED B0 AF 12 C9 21 00 A3 E5 2A 05    ....O.....!.£.*.
01ADF0:  95 5D 54 E1 0E 00 3A 07 95 47 7E FE 20 20 04 0C    .]T...:..G~.  ..
01AE00:  7E DD 77 19 E1 3E 01 CB 7E 20 0D 23 7E CB 7F 28    ~.w..>..~ .#~..(
01AE10:  07 E6 7F DD 77 06 18 53 DD 77 06 23 E5 7E F5 E6    ....w..S.w.#.~..
01AE20:  0F DD BE 05 28 06 DD 77 05 DD 72 0A 87 87 87 5F    ....(..w..r...._
01AE30:  21 42 64 19 50 59 ED A0 ED A0 ED A0 ED A0 ED A0    !Bd.PY..........
01AE40:  ED A0 ED A0 ED A0 F1 E1 E6 F0 28 1F FE F0 CA A0    ..........(.....
01AE50:  62 FE D0 CA BC 62 FE B0 CA C4 62 FE 80 D2 CC 62    b....b....b....b
01AE60:  FE 10 20 07 AF DD 77 1B DD 77 09 23 DD 75 00 DD    .. ...w..w.#.u..
01AE70:  74 01 DD 36 16 00 DD 36 17 20 DD 7E 17 B7 20 0E    t..6...6. .~.. .
01AE80:  DD 7E 15 B7 C8 DD 77 17 DD 7E 14 DD 77 16 16 00    .~....w..~..w...
01AE90:  DD 5E 16 DD 34 16 DD 35 17 DD 7E 1B B7 28 1A 67    .^..4..5..~..(.g
01AEA0:  DD 6E 1A 19 7E DD 46 07 80 87 42 4F 21 0C 63 09    .n..~.F...BO!.c.
01AEB0:  7E DD 77 18 23 7E DD 77 19 DD 66 0F DD 6E 0E 19    ~.w.#~.w..f..n..
01AEC0:  19 4E 23 46 DD 6E 18 DD 66 19 09 4D DD 7E 02 CD    .N#F.n..f..M.~..
01AED0:  E4 62 4C DD 7E 03 CD E4 62 DD 66 11 DD 6E 10 19    .bL.~...b.f..n..
01AEE0:  7E CB 7F 20 12 E6 0F DD 96 0A 30 01 AF DD B6 09    ~.. ......0.....
01AEF0:  4F DD 7E 04 CD E4 62 DD 6E 12 DD 66 13 19 7E CB    O.~...b.n..f..~.
01AF00:  7F C0 E6 1F DD 46 0B 4F B7 78 28 08 47 79 32 CF    .....F.O.x(.Gy2.
01AF10:  60 78 D6 40 32 9B 62 3A C0 60 CB 47 32 C0 60 C9    `x.@2.b:.`.G2.`.
01AF20:  23 7E E5 87 06 00 4F 21 C2 64 09 5E 23 56 DD 73    #~....O!.d.^#V.s
01AF30:  1A DD 72 1B DD 36 09 00 E1 C3 EB 61 23 7E 32 BB    ..r..6.....a#~2.
01AF40:  60 C3 EB 61 23 7E DD 77 0A C3 EB 61 DD 36 09 10    `..a#~.w...a.6..
01AF50:  DD 36 1B 00 7E 0F 0F 0F 0F 32 ED 60 23 7E 32 DE    .6..~....2.`#~2.
01AF60:  60 C3 EB 61 06 F4 ED 79 06 F6 ED 78 F6 C0 ED 79    `..a...y...x...y
01AF70:  E6 3F ED 79 06 F4 ED 49 06 F6 4F F6 80 ED 79 ED    .?.y...I..O...y.
01AF80:  49 C9 FF FF FF FF 22 67 64 67 A6 67 EE 0E 18 0E    I....."gdg.g....
01AF90:  4D 0D 8E 0C DA 0B 2F 0B 8F 0A F7 09 68 09 E1 08    M...../.....h...
01AFA0:  61 08 E9 07 77 07 0C 07 A7 06 47 06 ED 05 98 05    a...w.....G.....
01AFB0:  47 05 FC 04 B4 04 70 04 31 04 F4 03 BC 03 86 03    G.....p.1.......
01AFC0:  53 03 24 03 F6 02 CC 02 A4 02 7E 02 5A 02 38 02    S.$.......~.Z.8.
01AFD0:  18 02 FA 01 DE 01 C3 01 AA 01 92 01 7B 01 66 01    ............{.f.
01AFE0:  52 01 3F 01 2D 01 1C 01 0C 01 FD 00 EF 00 E1 00    R.?.-...........
01AFF0:  D5 00 C9 00 BE 00 B3 00 A9 00 9F 00 96 00 8E 00    ................
01B000:  23 10 F7 79 A7 28 0D 7E A7 20 02 18 1F EB 36 09    #..y.(.~. ....6.
01B010:  23 71 23 EB 7E A7 28 06 7E 12 23 13 18 F6 1B 1A    #q#.~.(.~.#.....
01B020:  13 FE 20 20 0B 1B 1A FE 20 28 FA 13 3E 0D 12 13    ..  .... (..>...
01B030:  6B 62 22 05 95 C9 CD 09 88 21 77 96 CD 06 88 AF    kb"......!w.....
01B040:  CD 18 BB FE FC C0 3E FF C9 CD 09 88 2A 05 95 01    ......>.....*...
01B050:  F4 11 7D B9 20 0D 7C B8 20 09 21 EC 96 CD 06 88    ..}. .|. .!.....
01B060:  C3 0C 88 2A 05 95 2B 7E FE 0D 28 FA 23 23 36 0A    ...*..+~..(.##6.
01B070:  22 05 95 21 B7 96 CD 06 88 CD 18 BB FE FC 20 09    "..!.......... .
01B080:  CD 09 88 CD 0F 88 C3 0C 88 21 14 88 11 6B 96 01    .........!...k..
01B090:  08 00 ED B0 3A 5A BB 32 08 95 3E C9 32 5A BB 21    ....:Z.2..>.2Z.!
01B0A0:  6B 96 06 0C 11 00 C0 CD 8C BC 30 21 11 F3 11 2A    k.........0!...*
01B0B0:  05 95 01 0C EE 09 23 23 EB 01 00 00 3E 02 CD 98    ......##....>...
01B0C0:  BC 30 0A CD 8F BC 30 05 CD 09 88 18 12 CD 92 BC    .0....0.........
01B0D0:  CD 09 88 3A 08 95 32 5A BB 21 04 97 CD 06 88 3A    ...:..2Z.!.....:
01B0E0:  08 95 32 5A BB CD 0F 88 C3 0C 88 20 20 20 20 20    ..2Z.......     
01B0F0:  20 20 20 2E 47 57 43 07 01 57 61 72 6E 69 6E 67       .GWC..Warning
01B100:  20 21 20 43 6F 6E 76 65 72 74 20 77 69 6C 6C 20     ! Convert will 
01B110:  65 72 61 73 65 20 74 65 78 74 20 69 6E 20 6D 65    erase text in me
01B120:  6D 6F 72 79 2E 2E 2E 20 28 45 73 63 29 20 74 6F    mory... (Esc) to
01B130:  20 61 62 6F 72 74 00 07 01 50 72 65 73 73 20 61     abort...Press a
01B140:  20 6B 65 79 20 74 6F 20 73 61 76 65 20 63 6F 6E     key to save con
01B150:  76 65 72 74 65 64 20 74 65 78 74 20 28 45 73 63    verted text (Esc
01B160:  29 20 74 6F 20 63 61 6E 63 65 6C 00 07 01 4E 6F    ) to cancel...No
01B170:  20 74 65 78 74 20 74 6F 20 63 6F 6E 76 65 72 74     text to convert
01B180:  2E 2E 2E 00 07 01 53 61 76 69 6E 67 20 65 72 72    ......Saving err
01B190:  6F 72 2E 2E 2E 00 07 01 45 72 72 6F 72 2E 2E 2E    or......Error...
01B1A0:  20 20 46 69 6C 65 20 68 61 73 20 6E 6F 20 6E 61      File has no na
01B1B0:  6D 65 2E 2E 2E 00 00 00 00 00 00 00 00 00 00 00    me..............
01B1C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B1D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B1E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B1F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B200:  86 00 7F 00 77 00 71 00 6A 00 64 00 5F 00 59 00    ....w.q.j.d._.Y.
01B210:  54 00 50 00 4B 00 47 00 43 00 3F 00 3C 00 38 00    T.P.K.G.C.?.<.8.
01B220:  35 00 32 00 2F 00 2D 00 2A 00 28 00 26 00 24 00    5.2./.-.*.(.&.$.
01B230:  22 00 20 00 1E 00 1C 00 1B 00 19 00 18 00 16 00    ". .............
01B240:  15 00 14 00 13 00 12 00 11 00 10 00 0F 00 00 00    ................
01B250:  00 00 00 00 00 00 00 00 00 00 00 00 00 01 08 00    ................
01B260:  00 00 00 00 00 DF 00 00 00 00 00 00 00 00 00 00    ................
01B270:  00 00 00 00 00 00 00 00 02 03 09 00 00 00 00 00    ................
01B280:  00 E7 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B290:  00 00 00 00 04 05 0A 00 00 00 00 00 00 EF 00 00    ................
01B2A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B2B0:  00 00 00 00 00 00 00 00 53 54 2D 4D 6F 64 75 6C    ........ST-Modul
01B2C0:  65 2E E2 64 22 65 42 65 08 00 62 65 A2 65 C2 65    e..d"eBe..be.e.e
01B2D0:  00 00 E2 65 22 66 42 65 10 10 E2 64 42 66 62 66    ...e"fBe...dBfbf
01B2E0:  00 00 E2 64 82 66 42 65 08 00 DC 5E DC 5E DC 5E    ...d.fBe...^.^.^
01B2F0:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
01B300:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
01B310:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
01B320:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
01B330:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
01B340:  00 00 A2 66 DC 5E C2 66 E2 66 02 67 DC 5E DC 5E    ...f.^.f.f.g.^.^
01B350:  DC 5E DC 5E DC 5E DC 5E DC 5E DC 5E DC 5E DC 5E    .^.^.^.^.^.^.^.^
01B360:  DC 5E 00 00 00 00 00 00 00 00 00 00 00 00 00 00    .^..............
01B370:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B380:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B390:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B3A0:  00 00 0E 0C 0C 0B 0A 09 08 08 08 09 0A 0A 0B 0B    ................
01B3B0:  0B 0B 0A 0A 0A 0A 0A 09 08 08 07 06 05 06 07 08    ................
01B3C0:  08 0A 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B3D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B3E0:  00 00 80 00 00 01 80 01 00 02 80 02 00 03 00 04    ................
01B3F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B400:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B410:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B420:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B430:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B440:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B450:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B460:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B470:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B480:  CD 09 88 CD 0F 88 C3 0C 88 21 14 88 11 6B 96 01    .........!...k..
01B490:  08 00 ED B0 3A 5A BB 32 08 95 3E C9 32 5A BB 21    ....:Z.2..>.2Z.!
01B4A0:  6B 96 06 0C 11 00 C0 CD 8C BC 30 21 11 F3 11 2A    k.........0!...*
01B4B0:  05 95 01 0C EE 09 23 23 EB 01 00 00 3E 02 CD 98    ......##....>...
01B4C0:  BC 30 0A CD 8F BC 30 05 CD 09 88 18 12 CD 92 BC    .0....0.........
01B4D0:  CD 09 88 3A 08 95 32 5A BB 21 04 97 CD 06 88 3A    ...:..2Z.!.....:
01B4E0:  08 95 32 5A BB CD 0F 88 C3 0C 88 20 20 20 20 20    ..2Z.......     
01B4F0:  20 20 20 2E 47 57 43 07 01 57 61 72 6E 69 6E 67       .GWC..Warning
01B500:  20 21 20 43 6F 6E 76 65 72 74 20 77 69 6C 6C 20     ! Convert will 
01B510:  65 72 61 73 65 20 74 65 78 74 20 69 6E 20 6D 65    erase text in me
01B520:  6D 6F 72 79 2E 2E 2E 20 28 45 73 63 29 20 74 6F    mory... (Esc) to
01B530:  20 61 62 6F 72 74 00 07 01 50 72 65 73 73 20 61     abort...Press a
01B540:  20 6B 65 79 20 74 6F 20 73 61 76 65 20 63 6F 6E     key to save con
01B550:  76 65 72 74 65 64 20 74 65 78 74 20 28 45 73 63    verted text (Esc
01B560:  29 20 74 6F 20 63 61 6E 63 65 6C 00 07 01 4E 6F    ) to cancel...No
01B570:  20 74 65 78 74 20 74 6F 20 63 6F 6E 76 65 72 74     text to convert
01B580:  2E 2E 2E 00 07 01 53 61 76 69 6E 67 20 65 72 72    ......Saving err
01B590:  6F 72 2E 2E 2E 00 07 01 45 72 72 6F 72 2E 2E 2E    or......Error...
01B5A0:  20 20 46 69 6C 65 20 68 61 73 20 6E 6F 20 6E 61      File has no na
01B5B0:  6D 65 2E 2E 2E 00 00 00 00 00 00 00 00 00 00 00    me..............
01B5C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B5D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B5E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B5F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B600:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
01B610:  17 00 01 00 02 09 4E E5 17 00 C1 02 00 00 00 02    ......N.........
01B620:  17 00 C6 02 00 00 00 02 17 00 C2 02 00 00 00 02    ................
01B630:  17 00 C7 02 00 00 00 02 17 00 C3 02 00 00 00 02    ................
01B640:  17 00 C8 02 00 00 00 02 17 00 C4 02 00 00 00 02    ................
01B650:  17 00 C9 02 00 00 00 02 17 00 C5 02 00 00 00 02    ................
01B660:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B670:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B680:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B690:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B6A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B6B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B6C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B6D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B6E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B6F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B700:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B710:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B720:  00 00 0F 0F 0E 0E 0D 0C 00 00 00 00 00 00 00 00    ................
01B730:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B740:  00 00 06 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B750:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B760:  00 00 01 00 01 00 01 00 01 00 00 00 00 00 00 00    ................
01B770:  00 00 01 00 01 00 01 00 01 00 00 00 00 00 00 00    ................
01B780:  00 00 01 00 01 00 01 00 01 00 00 00 00 00 00 00    ................
01B790:  00 00 01 00 01 00 01 00 01 00 00 00 00 00 00 00    ................
01B7A0:  00 00 0F 0E 0D 0C 80 80 80 80 80 80 80 80 80 80    ................
01B7B0:  80 80 80 80 80 80 80 80 80 80 80 80 80 80 80 80    ................
01B7C0:  80 80 0F 0D 0B 0B 07 05 04 06 08 06 04 02 00 00    ................
01B7D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B7E0:  00 00 05 05 05 07 0B 0F 13 07 05 05 05 05 05 05    ................
01B7F0:  05 05 05 05 05 05 05 05 05 05 05 05 05 05 05 05    ................
01B800:  05 05 0D 0C 0B 0A 09 08 08 08 08 08 08 08 08 08    ................
01B810:  08 08 08 08 08 08 08 08 07 06 05 04 03 02 01 00    ................
01B820:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B830:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B840:  00 00 00 03 07 0C 00 03 07 0C 00 03 07 0C 00 03    ................
01B850:  07 0C 00 03 07 0C 00 03 07 0C 00 03 07 0C 00 03    ................
01B860:  07 0C 01 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B870:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B880:  00 00 00 04 07 0C 00 04 07 0C 00 04 07 0C 00 04    ................
01B890:  07 0C 00 04 07 0C 00 04 07 0C 00 04 07 0C 00 04    ................
01B8A0:  07 0C 00 E8 67 00 E8 67 00 2C 68 00 6E 68 00 B0    ....g..g.,h.nh..
01B8B0:  68 00 F0 68 00 F0 68 00 4B 69 00 A6 69 00 4B 69    h..h..h.Ki..i.Ki
01B8C0:  00 01 6A 00 64 6A 00 E4 6A 00 E4 6A 00 03 6B 00    ..j.dj..j..j..k.
01B8D0:  16 6B 00 29 6B 00 41 6B 02 29 6B 02 41 6B 00 5B    .k.)k.Ak.)k.Ak.[
01B8E0:  6B 80 22 67 00 60 6B 00 60 6B 00 72 6B 00 84 6B    k."g.`k.`k.rk..k
01B8F0:  00 9C 6B 00 AE 6B 00 AE 6B 00 D6 6B 00 0A 6C 00    ..k..k..k..k..l.
01B900:  2F 82 23 82 2F 82 23 82 2F 82 22 02 04 2E 82 22    /.#./.#./."...."
01B910:  82 2E 82 22 82 2E 82 22 82 2E 82 FF 49 40 B2 0F    ..."..."....I@..
01B920:  FF 1A 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B930:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B940:  A1 0F 00 9D 04 2F 82 23 82 2F 82 23 82 2F 82 22    ...../.#./.#./."
01B950:  02 04 2E 82 22 82 2E 82 22 82 2E 82 22 82 2E 82    ...."..."..."...
01B960:  FF 49 40 B2 0F FF 1A 53 54 00 00 00 00 00 00 00    .I@....ST.......
01B970:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01B980:  33 02 C2 2D 2F 04 C2 38 2C 02 C2 44 36 04 C2 26    3..-/..8,..D6..&
01B990:  34 02 C2 2A 33 02 C2 2C 2F 06 C2 38 31 04 C2 32    4..*3..,/..81..2
01B9A0:  FF 31 04 C2 32 34 02 C2 2A 36 02 C2 26 38 04 C2    .1..24..*6..&8..
01B9B0:  22 3D 02 C2 19 3B 08 C2 1C 38 02 C2 22 36 02 C2    "=...;...8.."6..
01B9C0:  26 38 06 C2 22 36 04 C2 26 34 02 C2 2A 33 02 C2    &8.."6..&4..*3..
01B9D0:  2D 2F 04 C2 38 2C 02 C2 44 36 04 C2 26 34 02 C2    -/..8,..D6..&4..
01B9E0:  2A 33 02 C2 2C 2F 0A C2 38 FF 49 40 F1 00 FF 49    *3..,/..8.I@...I
01B9F0:  06 F2 03 4B 06 B2 00 4C 04 B2 0F 4B 06 B2 00 47    ...K...L...K...G
01BA00:  06 B2 0F 44 04 B2 00 49 10 B2 0F 47 10 B2 00 FF    ...D...I...G....
01BA10:  25 02 F0 00 31 02 00 25 82 31 82 25 82 31 82 25    %...1..%.1.%.1.%
01BA20:  82 31 82 28 82 34 82 28 82 34 82 28 82 34 82 28    .1.(.4.(.4.(.4.(
01BA30:  82 34 82 23 82 2F 82 23 82 2F 82 23 82 2F 82 23    .4.#./.#./.#./.#
01BA40:  82 2F 82 2A 82 36 82 2A 82 36 82 2A 82 36 82 2A    ./.*.6.*.6.*.6.*
01BA50:  82 36 82 FF 25 02 00 31 82 25 82 31 82 25 82 31    .6..%..1.%.1.%.1
01BA60:  82 25 82 31 82 28 82 34 82 28 82 34 82 28 82 34    .%.1.(.4.(.4.(.4
01BA70:  82 28 82 34 82 23 82 2F 82 23 82 2F 82 23 82 2F    .(.4.#./.#./.#./
01BA80:  82 23 82 2F 82 2A 82 36 82 2A 82 36 82 2A 82 36    .#./.*.6.*.6.*.6
01BA90:  82 2A 82 36 82 FF 25 02 00 31 82 25 82 31 82 25    .*.6..%..1.%.1.%
01BAA0:  82 31 82 25 82 31 82 28 82 34 82 28 82 34 82 28    .1.%.1.(.4.(.4.(
01BAB0:  82 34 82 28 82 34 82 23 82 2F 82 23 82 2F 82 23    .4.(.4.#./.#./.#
01BAC0:  82 2F 82 23 82 2F 82 22 02 04 2E 82 22 82 2E 82    ./.#./."...."...
01BAD0:  22 82 2E 82 22 82 2E 82 FF 25 02 00 31 82 25 82    "..."....%..1.%.
01BAE0:  31 82 25 82 31 82 25 82 31 82 28 82 34 82 28 82    1.%.1.%.1.(.4.(.
01BAF0:  34 82 28 82 34 82 28 82 34 82 23 82 2F 82 23 82    4.(.4.(.4.#./.#.
01BB00:  4C 6C 00 60 6C 00 86 6C 00 8B 6C 00 8B 6C 00 8B    Ll.`l..l..l..l..
01BB10:  6C 00 8B 6C 00 8B 6C 00 8B 6C 02 8B 6C 02 8B 6C    l..l..l..l..l..l
01BB20:  00 0B 6D 80 64 67 00 59 6D 00 59 6D 00 6A 6D 00    ..m.dg.Ym.Ym.jm.
01BB30:  7B 6D 00 8C 6D 00 9D 6D 00 9D 6D 00 AE 6D 00 BF    {m..m..m..m..m..
01BB40:  6D 00 D4 6D 00 21 6E 00 6A 6E 00 6F 6E 00 6F 6E    m..m.!n.jn.on.on
01BB50:  00 90 6E 00 D4 6E 00 16 6F 00 59 6F 02 16 6F 02    ..n..n..o.Yo..o.
01BB60:  59 6F 00 9C 6F 80 A6 67 25 02 F0 00 31 02 00 34    Yo..o..g%...1..4
01BB70:  82 38 82 25 82 31 82 34 82 38 82 28 82 34 82 38    .8.%.1.4.8.(.4.8
01BB80:  82 3B 82 28 82 34 82 38 82 3B 82 2A 82 36 82 3D    .;.(.4.8.;.*.6.=
01BB90:  82 3B 82 2A 82 36 82 3A 82 3B 82 2A 82 36 82 3D    .;.*.6.:.;.*.6.=
01BBA0:  82 3B 82 2A 82 36 82 3A 82 3B 82 FF 25 02 00 31    .;.*.6.:.;..%..1
01BBB0:  82 34 82 38 82 25 82 31 82 34 82 38 82 28 82 34    .4.8.%.1.4.8.(.4
01BBC0:  82 38 82 3B 82 28 82 34 82 38 82 3B 82 2A 82 36    .8.;.(.4.8.;.*.6
01BBD0:  82 3D 82 3B 82 2A 82 36 82 3A 82 3B 82 2A 82 36    .=.;.*.6.:.;.*.6
01BBE0:  82 3D 82 3B 82 2A 82 36 82 3A 82 3B 82 FF 2D 02    .=.;.*.6.:.;..-.
01BBF0:  00 39 82 40 82 3F 82 2D 82 39 82 3D 82 3F 82 2F    .9.@.?.-.9.=.?./
01BC00:  82 3B 82 40 82 3F 82 2F 82 3B 82 3B 82 38 82 2C    .;.@.?./.;.;.8.,
01BC10:  82 38 82 38 82 3B 82 2C 82 38 82 38 82 3D 82 2D    .8.8.;.,.8.8.=.-
01BC20:  82 39 82 39 82 3D 82 2D 82 39 82 39 82 3D 82 FF    .9.9.=.-.9.9.=..
01BC30:  2D 02 00 39 82 40 82 3F 82 2D 82 39 82 3D 82 3F    -..9.@.?.-.9.=.?
01BC40:  82 2F 82 3B 82 40 82 3F 82 2F 82 3B 82 3B 82 38    ./.;.@.?./.;.;.8
01BC50:  82 2C 82 38 82 38 82 3B 82 2C 82 38 82 38 82 36    .,.8.8.;.,.8.8.6
01BC60:  82 2D 82 39 82 38 82 34 82 2D 82 39 82 38 84 FF    .-.9.8.4.-.9.8..
01BC70:  49 02 F1 02 C9 04 49 82 49 82 C9 04 49 02 01 49    I.....I.I...I..I
01BC80:  02 04 C9 04 49 83 47 02 F1 04 C7 04 47 82 47 82    ....I.G.....G.G.
01BC90:  C7 04 47 02 01 47 02 04 C7 04 47 83 44 02 F1 02    ..G..G....G.D...
01BCA0:  C4 04 44 82 44 82 C4 04 44 02 01 44 02 04 44 82    ..D.D...D..D..D.
01BCB0:  44 82 42 02 F1 04 C2 04 42 82 42 82 C2 04 42 02    D.B.....B.B...B.
01BCC0:  01 42 02 04 C2 04 42 82 C2 04 FF 49 02 F1 02 C9    .B....B....I....
01BCD0:  04 49 82 49 82 C9 04 49 02 01 49 02 04 C9 04 49    .I.I...I..I....I
01BCE0:  83 4C 02 F1 04 CC 04 4C 82 4C 82 CC 04 4C 02 01    .L.....L.L...L..
01BCF0:  4C 02 04 CC 04 4C 83 44 02 F1 02 C4 04 44 82 44    L....L.D.....D.D
01BD00:  20 02 18 18 EB 36 09 23 71 23 EB 7E A7 28 06 7E     ....6.#q#.~.(.~
01BD10:  12 23 13 18 F6 1B 1A FE 20 28 FA 13 3E 0D 12 13    .#...... (..>...
01BD20:  6B 62 22 05 95 C9 CD 09 88 21 6D 96 CD 06 88 AF    kb"......!m.....
01BD30:  CD 18 BB FE FC C0 3E FF C9 CD 09 88 2A 05 95 01    ......>.....*...
01BD40:  F4 11 7D B9 20 0D 7C B8 20 09 21 E2 96 CD 06 88    ..}. .|. .!.....
01BD50:  C3 0C 88 2A 05 95 2B 7E FE 0D 28 FA 23 23 36 0A    ...*..+~..(.##6.
01BD60:  22 05 95 21 AD 96 CD 06 88 CD 18 BB FE FC 20 09    "..!.......... .
01BD70:  CD 09 88 CD 0F 88 C3 0C 88 21 14 88 11 61 96 01    .........!...a..
01BD80:  08 00 ED B0 3A 5A BB 32 08 95 3E C9 32 5A BB 21    ....:Z.2..>.2Z.!
01BD90:  61 96 06 0C 11 00 C0 CD 8C BC 30 21 11 F3 11 2A    a.........0!...*
01BDA0:  05 95 01 0C EE 09 23 23 EB 01 00 00 3E 02 CD 98    ......##....>...
01BDB0:  BC 30 0A CD 8F BC 30 05 CD 09 88 18 12 CD 92 BC    .0....0.........
01BDC0:  CD 09 88 3A 08 95 32 5A BB 21 FA 96 CD 06 88 3A    ...:..2Z.!.....:
01BDD0:  08 95 32 5A BB CD 0F 88 21 F4 11 22 05 95 C3 0C    ..2Z....!.."....
01BDE0:  88 20 20 20 20 20 20 20 20 2E 47 57 43 07 01 57    .        .GWC..W
01BDF0:  61 72 6E 69 6E 67 20 21 20 43 6F 6E 76 65 72 74    arning ! Convert
01BE00:  20 77 69 6C 6C 20 65 72 61 73 65 20 74 65 78 74     will erase text
01BE10:  20 69 6E 20 6D 65 6D 6F 72 79 2E 2E 2E 20 28 45     in memory... (E
01BE20:  53 43 20 74 6F 20 61 62 6F 72 74 29 00 07 01 50    SC to abort)...P
01BE30:  72 65 73 73 20 61 20 6B 65 79 20 74 6F 20 73 61    ress a key to sa
01BE40:  76 65 20 63 6F 6E 76 65 72 74 65 64 20 74 65 78    ve converted tex
01BE50:  74 20 28 45 53 43 20 74 6F 20 63 61 6E 63 65 6C    t (ESC to cancel
01BE60:  29 00 07 01 4E 6F 20 74 65 78 74 20 74 6F 20 63    )...No text to c
01BE70:  6F 6E 76 65 72 74 2E 2E 2E 00 07 01 53 61 76 69    onvert......Savi
01BE80:  6E 67 20 65 72 72 6F 72 2E 2E 2E 00 07 01 45 72    ng error......Er
01BE90:  72 6F 72 2E 2E 2E 20 20 46 69 6C 65 20 68 61 73    ror...  File has
01BEA0:  20 6E 6F 20 6E 61 6D 65 2E 2E 2E 00 00 00 00 00     no name........
01BEB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01BEC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01BED0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01BEE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01BEF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01BF00:  82 C4 04 44 02 01 44 02 04 44 82 44 82 42 02 F1    ...D..D..D.D.B..
01BF10:  04 C2 04 42 82 42 82 C2 04 42 02 01 42 02 04 C2    ...B.B...B..B...
01BF20:  04 42 82 C2 04 FF 49 02 F1 02 C9 04 49 82 49 82    .B....I.....I.I.
01BF30:  C9 04 49 02 01 49 02 04 C9 04 49 83 4C 02 F1 04    ..I..I....I.L...
01BF40:  CC 04 4C 82 4C 82 CC 04 4C 02 01 4C 02 04 CC 04    ..L.L...L..L....
01BF50:  4C 83 44 02 F1 02 C4 04 44 82 44 82 C4 04 44 02    L.D.....D.D...D.
01BF60:  01 44 02 04 44 82 44 82 42 02 F1 04 C2 04 42 82    .D..D.D.B.....B.
01BF70:  42 82 C2 04 42 02 01 42 02 04 C2 04 42 82 C2 04    B...B..B....B...
01BF80:  FF 49 02 F1 02 C9 04 49 82 49 82 C9 04 49 02 01    .I.....I.I...I..
01BF90:  49 02 04 C9 04 49 83 4C 02 F1 04 CC 04 4C 82 4C    I....I.L.....L.L
01BFA0:  82 CC 04 4C 02 01 4C 02 04 CC 04 4C 83 44 02 F1    ...L..L....L.D..
01BFB0:  02 C4 04 44 82 44 82 C4 04 44 02 01 44 02 04 44    ...D.D...D..D..D
01BFC0:  82 44 82 C2 F1 04 C2 03 C2 04 C2 04 C2 03 C2 04    .D..............
01BFD0:  C2 03 C2 04 42 02 01 C2 04 C2 03 C2 04 C2 04 C2    ....B...........
01BFE0:  03 C2 04 FF C9 F1 02 C9 04 C9 04 C9 04 C9 03 C9    ................
01BFF0:  04 C9 03 C9 04 C9 01 C9 03 C9 04 C9 03 C9 04 49    ...............I
01C000:  83 CC F1 04 CC 04 CC 04 CC 04 CC 03 CC 04 CC 03    ................
01C010:  CC 04 CC 01 CC 03 CC 04 CC 03 CC 04 CC 04 CC 03    ................
01C020:  CC 03 C4 F1 02 C4 04 C4 04 C4 04 C4 03 C4 04 C4    ................
01C030:  03 C4 04 C4 01 C4 03 C4 04 C4 03 C4 04 C4 03 44    ...............D
01C040:  02 04 C2 F1 04 C2 04 C2 04 C2 04 C2 03 C2 04 C2    ................
01C050:  03 C2 04 C2 01 C2 03 C2 04 C2 03 C2 04 C2 04 C2    ................
01C060:  03 C2 04 FF 49 06 F2 03 4B 06 B2 0F 4C 04 B2 00    ....I...K...L...
01C070:  4B 06 B2 0F 47 06 B2 00 44 04 B2 0F 49 10 B2 00    K...G...D...I...
01C080:  47 90 FF 49 06 B2 00 4B 86 4C 84 4B 86 47 86 44    G..I...K.L.K.G.D
01C090:  84 49 90 4B 90 FF 4C 06 B2 00 4E 86 50 84 4E 86    .I.K..L...N.P.N.
01C0A0:  4B 86 47 84 4C 90 4B 90 FF 50 10 02 4C 8C 50 84    K.G.L.K..P..L.P.
01C0B0:  4E 84 4B 82 53 84 4E 84 4E 84 49 84 52 86 53 84    N.K.S.N.N.I.R.S.
01C0C0:  FF 55 0E 02 55 82 53 86 50 86 53 84 4E 8F CC 02    .U..U.S.P.S.N...
01C0D0:  4E 84 4E 82 4C 84 4B 82 47 84 FF 49 40 B2 0F FF    N.N.L.K.G..I@...
01C0E0:  49 0E F2 00 47 02 02 4C 86 4B 86 47 84 47 90 49    I...G..L.K.G.G.I
01C0F0:  90 FF 4C 0E B2 00 49 02 02 50 86 4E 86 4B 84 4C    ..L...I..P.N.K.L
01C100:  00 4D 49 52 41 47 45 20 20 47 57 45 00 00 00 00    .MIRAGE  GWE....
01C110:  00 00 02 00 00 00 90 00 91 00 00 00 00 00 00 00    ................
01C120:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01C130:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01C140:  91 00 00 8C 04 0E 0C 0A 08 06 04 02 00 0F 0D 0B    ................
01C150:  09 07 05 03 01 FF 1A 00 00 00 00 00 00 00 00 00    ................
01C160:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01C170:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01C180:  8E 8C 8A 88 86 84 82 80 8F 8D 8B 89 87 85 83 81    ................
01C190:  7F 7D 7B 79 77 75 73 71 7E 7C 7A 78 76 74 72 70    .}{ywusq~|zxvtrp
01C1A0:  6E 6C 6A 68 66 64 62 60 6F 6D 6B 69 67 65 63 61    nljhfdb`omkigeca
01C1B0:  5F 5D 5B 59 57 55 53 51 5E 5C 5A 58 56 54 52 50    _][YWUSQ^\ZXVTRP
01C1C0:  4E 4C 4A 48 46 44 42 40 4F 4D 4B 49 47 45 43 41    NLJHFDB@OMKIGECA
01C1D0:  3F 3D 3B 39 37 35 33 31 3E 3C 3A 38 36 34 32 30    ?=;97531><:86420
01C1E0:  2E 2C 2A 28 26 24 22 20 2F 2D 2B 29 27 25 23 21    .,*(&$" /-+)'%#!
01C1F0:  1F 1D 1B 19 17 15 13 11 1E 1C 1A 18 16 14 12 10    ................
01C200:  0E 0C 0A 08 06 04 02 00 0F 0D 0B 09 07 05 03 01    ................
01C210:  FF 1A 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01C220:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01C230:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01C240:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01C250:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01C260:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01C270:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01C280:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
01C290:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
01C2A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
01C2B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
01C2C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
01C2D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
01C2E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
01C2F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
01C300:  90 4E 90 FF 51 06 02 50 86 4C 84 49 8C 4C 82 4E    .N..Q..P.L.I.L.N
01C310:  82 51 86 50 86 4C 84 47 86 49 8A FF 51 06 02 50    .Q.P.L.G.I..Q..P
01C320:  86 4C 84 55 90 53 86 51 86 50 84 4C 90 FF 49 0E    .L.U.S.Q.P.L..I.
01C330:  B2 00 47 02 02 4C 86 4B 86 47 84 47 8E C6 02 C7    ..G..L.K.G.G....
01C340:  02 49 82 CB 02 49 82 CB 02 49 82 CB 02 49 82 CB    .I...I...I...I..
01C350:  02 49 82 4B 82 FF 4C 10 B2 00 50 06 02 4E 86 4B    .I.K..L...P..N.K
01C360:  84 4C 82 CB 02 4C 82 CB 02 4C 82 CB 02 4C 82 CB    .L...L...L...L..
01C370:  02 4C 82 4B 82 4E 82 CC 02 4E 82 CC 02 4E 82 CC    .L.K.N...N...N..
01C380:  02 4E 82 CC 02 4E 82 4C 82 FF 50 02 02 D3 02 50    .N...N.L..P....P
01C390:  82 4E 82 50 83 4E 82 4C 82 4E 82 50 82 D3 02 50    .N.P.N.L.N.P...P
01C3A0:  82 4E 82 50 83 4E 82 4C 82 4E 82 4E 82 D0 02 4E    .N.P.N.L.N.N...N
01C3B0:  82 4C 82 4E 83 4C 82 4B 82 4C 82 4E 82 D0 02 4E    .L.N.L.K.L.N...N
01C3C0:  82 4C 82 4E 83 4C 82 4B 82 4C 82 FF 49 0E F2 00    .L.N.L.K.L..I...
01C3D0:  47 02 02 4C 86 4B 86 47 84 47 90 49 8E 4B 82 FF    G..L.K.G.G.I.K..
01C3E0:  4C 0E F2 00 49 02 02 50 86 4E 86 4B 84 4C 82 CB    L...I..P.N.K.L..
01C3F0:  02 4C 82 CB 02 4C 82 CB 02 4C 82 CB 02 4C 82 CB    .L...L...L...L..
01C400:  02 CC 02 4E 90 FF 49 40 B4 0F FF C9 F1 02 C9 04    ...N..I@........
01C410:  C9 04 C9 04 C9 03 C9 04 C9 03 C9 04 C9 01 C9 03    ................
01C420:  C9 04 C9 03 C9 04 49 83 CC F1 04 CC 04 CC 04 CC    ......I.........
01C430:  04 CC 03 CC 04 CC 03 CC 04 CC 01 CC 03 CC 04 CC    ................
01C440:  03 CC 04 CC 04 CC 03 CC 03 C4 F1 02 C4 04 C4 04    ................
01C450:  C4 04 C4 03 C4 04 C4 03 C4 04 C4 01 C4 03 C4 04    ................
01C460:  C4 03 C4 04 C4 03 44 02 04 C2 F1 04 C2 04 C2 04    ......D.........
01C470:  C2 04 C2 03 C2 04 C2 03 C2 04 C2 01 C2 03 C2 04    ................
01C480:  C2 03 C2 04 C2 04 C2 03 C2 04 FF 49 04 F1 02 49    ...........I...I
01C490:  02 03 49 82 C9 01 49 02 03 49 85 4C 04 F1 04 4C    ..I...I..I.L...L
01C4A0:  02 03 4C 82 CC 01 4C 02 03 4C 83 CC 03 CC 03 44    ..L...L..L.....D
01C4B0:  04 F1 02 44 02 03 44 82 C4 01 44 02 03 44 82 44    ...D..D...D..D.D
01C4C0:  83 42 04 F1 04 42 02 03 42 82 C2 01 42 02 03 C2    .B...B..B...B...
01C4D0:  01 42 02 03 C2 01 AA 03 FF 25 10 C2 65 28 10 C2    .B.......%..e(..
01C4E0:  55 2C 10 C2 43 2A 10 C2 4B FF 25 10 C2 65 28 10    U,..C*..K.%..e(.
01C4F0:  C2 55 2C 10 C2 43 2A 10 C2 4B FF 2D 10 C0 3F 2A    .U,..C*..K.-..?*
01C500:  78 74 20 20 5B 46 5D 6F 6E 74 20 20 5B 4C 5D 6F    xt  [F]ont  [L]o
01C510:  67 6F 20 20 5B 4D 5D 75 73 69 63 20 20 5B 31 5D    go  [M]usic  [1]
01C520:  73 74 20 73 66 78 20 20 20 5B 32 5D 6E 64 20 73    st sfx   [2]nd s
01C530:  66 78 00 04 01 43 6F 6D 6D 61 6E 64 20 20 20 3A    fx...Command   :
01C540:  20 28 44 29 69 72 20 20 20 28 41 29 3A 20 20 20     (D)ir   (A):   
01C550:  20 28 42 29 3A 20 20 20 20 28 4F 29 70 65 6E 20     (B):    (O)pen 
01C560:  20 20 28 53 29 61 76 65 20 61 6C 6C 20 20 28 43      (S)ave all  (C
01C570:  29 6F 6E 66 69 67 20 20 28 56 29 69 65 77 00 05    )onfig  (V)iew..
01C580:  01 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A    ................
01C590:  9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A    ................
01C5A0:  9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A    ................
01C5B0:  9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A    ................
01C5C0:  9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A    ................
01C5D0:  9A 00 01 3A 46 69 6C 65 20 20 20 3A 20 20 3A 20    ...:File   :  : 
01C5E0:  20 20 20 20 20 20 20 2E 20 20 20 00 CD 18 BB FE           .   .....
01C5F0:  31 CA 17 0F FE 32 CA 1E 0F E6 DF FE 49 CA 03 0B    1....2......I...
01C600:  FE 44 CA 52 09 FE 4F CA 88 0B FE 53 CA 38 0D FE    .D.R..O....S.8..
01C610:  41 CA 9E 0E FE 42 CA AB 0E FE 54 CA D2 0E FE 4C    A....B....T....L
01C620:  CA 09 0F FE 46 CA 10 0F FE 4D CA 02 0F FE 43 C2    ....F....M....C.
01C630:  F8 0A CD 40 00 C3 AC 0A FE 56 C2 AC 0A CD 43 00    ...@.....V....C.
01C640:  C3 A5 08 CD F7 08 21 1B 0B CD E5 08 21 39 0B CD    ......!.....!9..
01C650:  E5 08 21 58 0B CD E5 08 C3 AC 0A 0B 1B 47 68 6F    ..!X.........Gho
01C660:  75 6C 27 73 20 57 72 69 74 65 72 20 4C 69 6E 6B    ul's Writer Link
01C670:  65 72 20 20 76 31 2E 30 00 0D 1A 43 6F 64 65 64    er  v1.0...Coded
01C680:  20 62 79 20 54 6F 6D 20 65 74 20 4A 65 72 72 79     by Tom et Jerry
01C690:  20 6F 66 20 47 50 41 00 0F 1A 54 68 69 73 20 70     of GPA...This p
01C6A0:  72 6F 67 72 61 6D 20 69 73 20 73 68 61 72 65 77    rogram is sharew
01C6B0:  61 72 65 20 21 21 00 0E FF 0C D6 0A 30 FB C6 3A    are !!......0..:
01C6C0:  23 77 2B 79 C6 30 77 C9 CD F7 08 CD 1A 09 21 2B    #w+y.0w.......!+
01C6D0:  0C CD E5 08 21 0B 08 11 1A 08 01 0C 00 ED B0 21    ....!..........!
01C6E0:  18 08 CD 9B 0C FE FC 20 06 CD F7 08 C3 AC 0A CD    ....... ........
01C6F0:  F7 08 3A 5A BB 32 27 08 3E C9 32 5A BB 21 1A 08    ..:Z.2'.>.2Z.!..
01C700:  10 C0 4C 28 10 C0 54 2D 10 C0 3F FF 2D 10 C0 3F    ..L(..T-..?.-..?
01C710:  2A 10 C0 4C 28 10 C0 54 2D 10 C0 3F FF 25 10 C2    *..L(..T-..?.%..
01C720:  65 28 10 C2 55 2C 10 C2 43 2A 10 C2 4B FF 25 10    e(..U,..C*..K.%.
01C730:  C2 65 28 10 C2 55 2C 10 C2 43 2A 10 C2 4B FF 31    .e(..U,..C*..K.1
01C740:  10 C2 32 34 10 C2 2A 2F 10 C2 38 36 08 C2 26 2F    ..24..*/..86..&/
01C750:  08 C2 38 FF 31 04 C2 32 34 02 C2 2A 36 02 C2 26    ..8.1..24..*6..&
01C760:  38 04 C2 22 3D 02 C2 19 3B 08 C2 1C 38 02 C2 22    8.."=...;...8.."
01C770:  36 02 C2 26 38 06 C2 22 36 04 C2 26 34 02 C2 2A    6..&8.."6..&4..*
01C780:  33 02 C2 2D 2F 04 C2 38 2C 02 C2 44 36 04 C2 26    3..-/..8,..D6..&
01C790:  34 02 C2 2A 33 02 C2 2C 2F 06 C2 38 31 04 C2 32    4..*3..,/..81..2
01C7A0:  FF 31 04 C2 32 34 02 C2 2A 36 02 C2 26 38 04 C2    .1..24..*6..&8..
01C7B0:  22 3D 02 C2 19 3B 08 C2 1C 38 02 C2 22 36 02 C2    "=...;...8.."6..
01C7C0:  26 38 06 C2 22 36 04 C2 26 34 02 C2 2A 33 02 C2    &8.."6..&4..*3..
01C7D0:  2D 2F 04 C2 38 2C 02 C2 44 36 04 C2 26 34 02 C2    -/..8,..D6..&4..
01C7E0:  2A 33 02 C2 2C 2F 0A C2 38 FF 49 40 F1 00 FF 49    *3..,/..8.I@...I
01C7F0:  06 F2 03 4B 06 B2 00 4C 04 B2 0F 4B 06 B2 00 47    ...K...L...K...G
01C800:  06 B2 0F 44 04 B2 00 49 10 B2 0F 47 10 B2 00 FF    ...D...I...G....
01C810:  25 02 F0 00 31 02 00 25 82 31 82 25 82 31 82 25    %...1..%.1.%.1.%
01C820:  82 31 82 28 82 34 82 28 82 34 82 28 82 34 82 28    .1.(.4.(.4.(.4.(
01C830:  82 34 82 23 82 2F 82 23 82 2F 82 23 82 2F 82 23    .4.#./.#./.#./.#
01C840:  82 2F 82 2A 82 36 82 2A 82 36 82 2A 82 36 82 2A    ./.*.6.*.6.*.6.*
01C850:  82 36 82 FF 25 02 00 31 82 25 82 31 82 25 82 31    .6..%..1.%.1.%.1
01C860:  82 25 82 31 82 28 82 34 82 28 82 34 82 28 82 34    .%.1.(.4.(.4.(.4
01C870:  82 28 82 34 82 23 82 2F 82 23 82 2F 82 23 82 2F    .(.4.#./.#./.#./
01C880:  82 23 82 2F 82 2A 82 36 82 2A 82 36 82 2A 82 36    .#./.*.6.*.6.*.6
01C890:  82 2A 82 36 82 FF 25 02 00 31 82 25 82 31 82 25    .*.6..%..1.%.1.%
01C8A0:  82 31 82 25 82 31 82 28 82 34 82 28 82 34 82 28    .1.%.1.(.4.(.4.(
01C8B0:  82 34 82 28 82 34 82 23 82 2F 82 23 82 2F 82 23    .4.(.4.#./.#./.#
01C8C0:  82 2F 82 23 82 2F 82 22 02 04 2E 82 22 82 2E 82    ./.#./."...."...
01C8D0:  22 82 2E 82 22 82 2E 82 FF 25 02 00 31 82 25 82    "..."....%..1.%.
01C8E0:  31 82 25 82 31 82 25 82 31 82 28 82 34 82 28 82    1.%.1.%.1.(.4.(.
01C8F0:  34 82 28 82 34 82 28 82 34 82 23 82 2F 82 23 82    4.(.4.(.4.#./.#.
01C900:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
01C910:  18 00 01 00 02 09 4E E5 18 00 C1 02 00 00 00 02    ......N.........
01C920:  18 00 C6 02 00 00 00 02 18 00 C2 02 00 00 00 02    ................
01C930:  18 00 C7 02 00 00 00 02 18 00 C3 02 00 00 00 02    ................
01C940:  18 00 C8 02 00 00 00 02 18 00 C4 02 00 00 00 02    ................
01C950:  18 00 C9 02 00 00 00 02 18 00 C5 02 00 00 00 02    ................
01C960:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01C970:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01C980:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01C990:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01C9A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01C9B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01C9C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01C9D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01C9E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01C9F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CA00:  00 4E 4F 20 20 20 20 20 20 47 57 4C 00 00 00 00    .NO      GWL....
01CA10:  00 00 02 00 00 00 7E 00 E0 0D 00 00 00 00 00 00    ......~.........
01CA20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CA30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CA40:  E0 0D 00 A1 04 00 00 00 00 00 00 00 00 00 00 00    ................
01CA50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CA60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CA70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CA80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CA90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CAA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CAB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CAC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CAD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CAE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CAF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CB00:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CB10:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CB20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CB30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CB40:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CB50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CB60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CB70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CB80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CB90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CBA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CBB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CBC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CBD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CBE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CBF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CC00:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CC10:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CC20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CC30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CC40:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CC50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CC60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CC70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CC80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CC90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CCA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CCB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CCC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CCD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CCE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CCF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CD00:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CD10:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CD20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CD30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CD40:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CD50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CD60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CD70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CD80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CD90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CDA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CDB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CDC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CDD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CDE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CDF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CE00:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CE10:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CE20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CE30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CE40:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CE50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CE60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CE70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CE80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CE90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CEA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CEB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CEC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CED0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CEE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CEF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CF00:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CF10:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CF20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CF30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CF40:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CF50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CF60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CF70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CF80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CF90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CFA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CFB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CFC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CFD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CFE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01CFF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D000:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D010:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D020:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D030:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D040:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D050:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D060:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D070:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D080:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D090:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D0A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D0B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D0C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D0D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D0E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D0F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D100:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D110:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D120:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D130:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D140:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D150:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D160:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D170:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D180:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D190:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D1A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D1B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D1C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D1D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D1E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D1F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D200:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D210:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D220:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D230:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D240:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D250:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D260:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D270:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D280:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D290:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D2A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D2B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D2C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D2D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D2E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D2F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D300:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D310:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D320:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D330:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D340:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D350:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D360:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D370:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D380:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D390:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D3A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D3B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D3C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D3D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D3E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D3F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D400:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D410:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D420:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D430:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D440:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D450:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D460:  1A 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D470:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D480:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D490:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D4A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D4B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D4C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D4D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D4E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D4F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D500:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D510:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D520:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D530:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D540:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D550:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D560:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D570:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D580:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D590:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D5A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D5B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D5C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D5D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D5E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D5F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D600:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D610:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D620:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D630:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D640:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D650:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D660:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D670:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D680:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D690:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D6A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D6B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D6C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D6D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D6E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D6F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D700:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D710:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D720:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D730:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D740:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D750:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D760:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D770:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D780:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D790:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D7A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D7B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D7C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D7D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D7E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D7F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D800:  00 50 49 47 20 20 20 20 20 47 57 4C 00 00 00 00    .PIG     GWL....
01D810:  00 00 02 00 00 00 7E 00 E0 0D 00 00 00 00 00 00    ......~.........
01D820:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D830:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D840:  E0 0D 00 C4 04 00 00 00 00 00 00 00 00 00 00 00    ................
01D850:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D860:  00 00 60 80 00 00 A0 00 00 00 00 00 00 00 00 00    ..`.............
01D870:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D880:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 80 00    ................
01D890:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D8A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D8B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D8C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D8D0:  00 00 00 00 00 00 00 10 80 00 00 00 00 00 00 00    ................
01D8E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D8F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D900:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D910:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D920:  00 70 80 00 00 00 00 00 00 00 00 00 00 00 00 00    .p..............
01D930:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D940:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D950:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D960:  00 00 00 00 00 00 00 00 00 00 00 F0 80 00 00 00    ................
01D970:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D980:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D990:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D9A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D9B0:  00 00 00 00 70 F0 00 00 00 00 00 00 00 00 00 00    ....p...........
01D9C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D9D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D9E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01D9F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 10 F0 F0    ................
01DA00:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DA10:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DA20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DA30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DA40:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DA50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DA60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DA70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DA80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DA90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DAA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DAB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DAC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DAD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DAE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DAF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DB00:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DB10:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DB20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DB30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DB40:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DB50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DB60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DB70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DB80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DB90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DBA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DBB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DBC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DBD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DBE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DBF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DC00:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
01DC10:  19 00 01 00 02 09 50 E5 19 00 C1 02 00 00 00 02    ......P.........
01DC20:  19 00 C6 02 00 00 00 02 19 00 C2 02 00 00 00 02    ................
01DC30:  19 00 C7 02 00 00 00 02 19 00 C3 02 00 00 00 02    ................
01DC40:  19 00 C8 02 00 00 00 02 19 00 C4 02 00 00 00 02    ................
01DC50:  19 00 C9 02 00 00 00 02 19 00 C5 02 00 00 00 02    ................
01DC60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DC70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DC80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DC90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DCA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DCB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DCC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DCD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DCE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DCF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DD00:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DD10:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DD20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DD30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DD40:  00 00 00 00 00 00 00 70 F0 F0 00 00 00 00 00 00    .......p........
01DD50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DD60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DD70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DD80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DD90:  00 F0 F0 E0 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DDA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DDB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DDC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DDD0:  00 00 00 00 00 00 00 00 00 00 30 F0 F0 E0 00 10    ..........0.....
01DDE0:  80 00 00 00 00 00 00 00 00 00 00 00 77 FF 00 00    ............w...
01DDF0:  00 00 00 00 00 00 33 88 00 00 33 FF 00 00 00 00    ......3...3.....
01DE00:  00 00 00 00 00 00 33 EE 00 00 11 EE 33 88 00 00    ......3.....3...
01DE10:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DE20:  00 00 00 00 70 F0 F0 C0 00 F0 00 00 00 00 00 00    ....p...........
01DE30:  00 00 00 00 00 00 77 FF 00 00 00 00 00 00 00 00    ......w.........
01DE40:  33 88 00 00 00 EE 00 00 00 00 00 00 00 00 00 00    3...............
01DE50:  77 77 00 00 33 88 33 88 00 00 00 00 00 00 00 00    ww..3.3.........
01DE60:  00 00 00 00 00 00 00 00 00 00 00 00 00 20 F0 F0    ............. ..
01DE70:  F0 80 30 F0 00 00 00 00 00 00 00 00 00 00 00 00    ..0.............
01DE80:  11 CC 33 EE 33 66 00 00 33 EE 77 EE 00 00 00 E0    ..3.3f..3.w.....
01DE90:  33 EE 77 EE 77 EE 77 77 00 00 70 00 33 EE 33 88    3.w.w.ww..p.3.3.
01DEA0:  77 EE 66 33 33 EE 77 EE 33 EE 00 00 00 00 00 00    w.f33.w.3.......
01DEB0:  00 00 00 00 00 00 30 D0 F0 F0 F0 00 70 E0 00 00    ......0.....p...
01DEC0:  00 00 00 00 00 00 00 00 00 00 10 C0 70 70 70 F0    ............ppp.
01DED0:  00 00 70 70 30 80 00 00 00 E0 70 70 70 77 70 77    ..pp0.....pppwpw
01DEE0:  70 71 00 00 30 E0 70 70 70 E0 30 80 60 B0 00 70    pq..0.ppp.0.`..p
01DEF0:  70 77 70 70 00 00 00 00 00 00 00 00 00 00 00 10    pwpp............
01DF00:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DF10:  00 00 00 00 00 30 70 B0 E0 B0 D0 90 66 F0 C0 00    .....0p.....f...
01DF20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DF30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DF40:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DF50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 30    ...............0
01DF60:  F0 D0 F0 30 E0 C0 10 F0 80 00 00 00 00 00 00 00    ...0............
01DF70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DF80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DF90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DFA0:  00 00 00 00 00 00 00 00 00 10 F0 D0 F0 D0 F0 70    ...............p
01DFB0:  F0 C0 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DFC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DFD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DFE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01DFF0:  00 00 00 00 70 E0 F0 D0 F0 B0 F0 90 00 00 00 00    ....p...........
01E000:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E010:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E020:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E030:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 30 F0    ..............0.
01E040:  10 E0 F0 C0 00 30 80 00 00 00 00 00 00 00 00 00    .....0..........
01E050:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E060:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E070:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E080:  00 00 00 00 00 00 00 00 00 F0 80 00 70 E0 00 20    ............p.. 
01E090:  80 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E0A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E0B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E0C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E0D0:  00 00 00 60 80 00 10 A0 00 00 00 00 00 00 00 00    ...`............
01E0E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E0F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E100:  F0 D0 E0 F0 F0 00 F0 C0 00 00 00 00 00 00 00 00    ................
01E110:  00 00 00 00 10 C0 70 70 60 B0 00 00 70 F0 30 80    ......pp`...p.0.
01E120:  00 00 66 E0 70 F0 70 00 70 00 70 71 00 00 00 70    ..f.p.p.p.pq...p
01E130:  70 70 30 80 30 80 60 B0 30 F0 70 00 70 F0 00 00    pp0.0.`.0.p.p...
01E140:  00 00 00 00 00 00 00 00 00 70 F0 F0 D0 B0 F0 D0    .........p......
01E150:  F0 C0 00 00 00 00 00 00 00 00 00 00 00 00 11 CC    ................
01E160:  77 77 66 BB 00 00 77 00 33 88 00 00 66 EE 77 00    wwf...w.3...f.w.
01E170:  77 00 77 00 33 FF 00 00 77 77 77 77 33 88 33 88    w.w.3...wwww3.3.
01E180:  77 FF 77 77 77 00 77 00 00 00 00 00 00 00 00 00    w.www.w.........
01E190:  00 00 00 F0 F0 F0 B0 70 E0 70 F0 80 00 00 00 00    .......p.p......
01E1A0:  00 00 00 00 00 00 00 00 11 CC 33 EE 66 33 00 00    ..........3.f3..
01E1B0:  33 EE 11 EE 00 00 33 CC 33 EE 77 00 77 00 00 77    3.....3.3.w.w..w
01E1C0:  00 00 33 EE 33 EE 33 88 11 EE 33 66 33 FF 77 00    ..3.3.3...3f3.w.
01E1D0:  33 EE 00 00 00 00 00 00 00 00 00 00 30 F0 F0 F0    3...........0...
01E1E0:  70 F0 D0 A0 70 80 00 00 00 00 00 00 00 00 00 00    p...p...........
01E1F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E200:  00 00 00 00 00 00 00 00 33 EE 00 00 00 00 00 00    ........3.......
01E210:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E220:  00 00 00 00 00 00 70 F0 F0 F0 F0 F0 F0 D0 B0 00    ......p.........
01E230:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E240:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E250:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E260:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E270:  70 F0 F0 F0 F0 F0 C0 70 B0 00 00 00 00 00 00 00    p......p........
01E280:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E290:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E2A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E2B0:  00 00 00 00 00 00 00 00 00 00 F0 F0 F0 F0 F0 10    ................
01E2C0:  83 08 F0 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E2D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E2E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E2F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E300:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E310:  00 00 00 00 00 00 00 00 00 00 00 00 00 60 80 00    .............`..
01E320:  00 A0 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E330:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E340:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E350:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E360:  1A 00 60 80 00 00 A0 00 00 00 00 00 00 00 00 00    ..`.............
01E370:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E380:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E390:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E3A0:  00 00 00 00 00 00 00 00 00 10 F0 D0 F0 D0 F0 70    ...............p
01E3B0:  F0 C0 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E3C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E3D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E3E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E3F0:  00 00 00 00 70 E0 F0 D0 F0 B0 F0 90 00 00 00 00    ....p...........
01E400:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E410:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E420:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E430:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 30 F0    ..............0.
01E440:  10 E0 F0 C0 00 30 80 00 00 00 00 00 00 00 00 00    .....0..........
01E450:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E460:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E470:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E480:  00 00 00 00 00 00 00 00 00 F0 80 00 70 E0 00 20    ............p.. 
01E490:  80 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E4A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E4B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E4C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E4D0:  00 00 00 60 80 00 10 A0 00 00 00 00 00 00 00 00    ...`............
01E4E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E4F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E500:  00 00 00 10 F0 F0 F0 F0 E0 E0 82 0F 70 80 00 E0    ............p...
01E510:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E520:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E530:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E540:  00 00 00 00 00 00 00 00 00 00 00 00 00 10 F0 F0    ................
01E550:  F0 F0 D0 F0 82 0D 70 60 D0 F0 00 00 00 00 00 00    ......p`........
01E560:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E570:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E580:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E590:  00 00 00 00 00 00 00 30 F0 F0 F0 F0 F0 90 C0 05    .......0........
01E5A0:  60 D0 B0 F0 00 00 00 00 00 00 33 EE 00 00 33 CC    `.........3...3.
01E5B0:  33 CC 00 00 00 00 00 00 00 00 00 00 11 CC 00 00    3...............
01E5C0:  00 00 00 00 00 00 00 00 00 77 00 00 00 00 00 00    .........w......
01E5D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E5E0:  00 30 F0 F0 F0 F0 F0 30 F0 80 F0 B0 B0 F0 80 00    .0.....0........
01E5F0:  00 00 00 00 77 77 00 00 11 CC 11 CC 00 00 00 00    ....ww..........
01E600:  00 00 00 00 00 00 33 CC 00 00 00 00 00 00 00 00    ......3.........
01E610:  00 00 00 77 00 00 00 00 00 00 00 00 00 00 00 00    ...w............
01E620:  00 00 00 00 00 00 00 00 00 00 00 70 F0 F0 F0 F0    ...........p....
01E630:  E0 1C F0 F0 F0 B0 70 F0 80 00 00 00 00 00 70 00    ......p.......p.
01E640:  33 EE 11 CC 11 CC 33 EE 33 FF 33 EE 00 00 00 00    3.....3.3.3.....
01E650:  10 C0 00 00 77 EE 77 77 33 EE 00 00 33 FF 33 EE    ....w.ww3...3.3.
01E660:  33 FF 00 00 33 EE 77 EE 33 66 33 EE 33 FF 00 00    3...3.w.3f3.3...
01E670:  00 00 00 00 00 70 F0 F0 F0 F0 E0 1C F0 F0 F0 F0    .....p..........
01E680:  70 F0 80 00 00 00 00 00 70 00 70 70 10 C0 10 C0    p.......p.pp....
01E690:  70 70 70 70 70 70 00 00 00 00 10 C0 00 00 70 77    pppppp........pw
01E6A0:  70 70 70 70 00 00 70 70 70 70 70 00 00 00 70 70    pppp..ppppp...pp
01E6B0:  70 77 70 F0 70 70 70 00 00 00 00 00 00 00 00 70    pwp.ppp........p
01E6C0:  F0 F0 F0 F0 C1 1C F0 F0 F0 F0 70 F0 80 00 00 00    ..........p.....
01E6D0:  00 00 70 00 70 70 10 C0 10 C0 70 F0 70 70 70 F0    ..p.pp....p.ppp.
01E6E0:  00 00 00 00 10 C0 00 00 70 00 70 70 70 F0 00 00    ........p.ppp...
01E6F0:  70 70 70 F0 30 E0 00 00 70 70 70 00 60 B0 70 F0    ppp.0...ppp.`.p.
01E700:  00 53 49 4C 56 45 52 4D 41 4D 55 53 00 00 00 00    .SILVERMAMUS....
01E710:  00 00 02 00 00 00 60 00 E1 14 00 60 00 00 00 00    ......`....`....
01E720:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E730:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E740:  E1 14 00 04 06 D0 B1 05 D0 B1 05 D0 B1 05 D0 B1    ................
01E750:  05 D3 B1 02 D3 B1 02 D3 B1 02 D3 B1 02 D3 B1 03    ................
01E760:  D3 B1 03 D3 B1 03 D3 B1 03 D3 B1 04 D3 B1 04 D3    ................
01E770:  B1 04 D3 B1 04 D3 B1 05 D3 B1 05 D3 B1 05 D3 B1    ................
01E780:  C3 0B 60 C3 93 60 C3 77 60 66 04 06 03 DD 21 DA    ..`..`.w`f....!.
01E790:  63 FD 21 06 63 11 1C 00 C5 DD 36 06 01 DD 72 09    c.!.c.....6...r.
01E7A0:  DD 72 1B DD 36 05 10 FD 6E 00 FD 66 01 7E DD 77    .r..6...n..f.~.w
01E7B0:  08 23 4E 23 46 23 DD 75 0C DD 74 0D DD 71 00 DD    .#N#F#.u..t..q..
01E7C0:  70 01 DD 19 FD 23 FD 23 C1 10 CD 3E 05 32 BB 60    p....#.#...>.2.`
01E7D0:  7A 32 CF 60 3C 32 B6 60 3E 38 32 C0 60 3E FF 32    z2.`<2.`>82.`>.2
01E7E0:  02 63 32 03 63 32 04 63 32 05 63 3E 0C 4A CD E4    .c2.c2.c2.c>.J..
01E7F0:  62 3E 0D 4A C3 E4 62 3E 07 0E 3F CD E4 62 3E 08    b>.J..b>..?..b>.
01E800:  0E 00 CD E4 62 3E 09 0E 00 CD E4 62 3E 0A 0E 00    ....b>.....b>...
01E810:  C3 E4 62 21 B6 60 35 DD 21 DA 63 01 E8 63 CD 49    ..b!.`5.!.c..c.I
01E820:  61 DD 21 F6 63 01 04 64 CD 49 61 DD 21 12 64 01    a.!.c..d.Ia.!.d.
01E830:  20 64 CD 49 61 3E 00 B7 20 05 3E 00 32 B6 60 3E     d.Ia>.. .>.2.`>
01E840:  00 21 03 63 BE 28 07 77 4F 3E 07 CD E4 62 3E 00    .!.c.(.wO>...b>.
01E850:  21 02 63 BE 28 07 77 4F 3E 06 CD E4 62 3E 00 21    !.c.(.wO>...b>.!
01E860:  04 63 BE 28 07 77 4F 3E 0B CD E4 62 3E 00 21 05    .c.(.wO>...b>.!.
01E870:  63 BE C8 77 4F 3E 0D C3 E4 62 23 46 DD 70 06 23    c..wO>...b#F.p.#
01E880:  DD 75 00 DD 74 01 C3 FA 61 23 7E DD 77 06 23 DD    .u..t...a#~.w.#.
01E890:  75 00 DD 74 01 AF DD 77 17 DD 77 15 4F DD 7E 04    u..t...w..w.O.~.
01E8A0:  C3 E4 62 DD 36 0A 00 DD 6E 0C DD 66 0D 7E FE 80    ..b.6...n..f.~..
01E8B0:  20 06 23 5E 23 56 EB 7E 23 5E 23 56 23 DD 75 0C     .#^#V.~#^#V#.u.
01E8C0:  DD 74 0D DD 77 08 EB 18 13 3A B6 60 B7 C2 FA 61    .t..w....:.`...a
01E8D0:  DD 35 06 C2 FA 61 DD 6E 00 DD 66 01 7E B7 28 9A    .5...a.n..f.~.(.
01E8E0:  FE FE 28 A5 FE FF 28 BB 16 00 E6 7F D6 0A DD 86    ..(...(.........
01E8F0:  08 DD 77 07 87 5F E5 21 0C 63 19 7E DD 77 18 23    ..w.._.!.c.~.w.#
01E900:  30 E0 00 00 00 00 00 00 00 F0 F0 F0 F0 F0 C1 0E    0...............
01E910:  F0 F0 F0 E0 D0 D0 80 00 00 00 00 00 77 77 77 77    ............wwww
01E920:  11 CC 11 CC 77 00 33 FF 77 00 11 CC 00 00 11 CC    ....w.3.w.......
01E930:  00 00 77 00 77 77 77 00 00 00 77 77 77 00 00 77    ..w.www...www..w
01E940:  00 00 77 77 77 00 66 BB 77 00 00 77 00 00 00 00    ..www.f.w..w....
01E950:  00 00 00 F0 F0 F0 F0 F0 C1 0E F0 F0 F0 E0 D0 D0    ................
01E960:  80 00 00 00 00 00 33 EE 33 EE 33 EE 33 EE 33 EE    ......3.3.3.3.3.
01E970:  00 77 33 EE 11 CC 00 00 77 FF 00 00 77 00 33 FF    .w3.....w...w.3.
01E980:  33 EE 00 00 33 FF 33 EE 77 EE 00 00 33 EE 77 00    3...3.3.w...3.w.
01E990:  66 33 33 EE 77 EE 00 00 00 00 00 00 00 F0 F0 F0    f33.w...........
01E9A0:  F0 F0 80 07 70 F0 F0 E0 A0 A0 80 00 00 00 00 00    ....p...........
01E9B0:  00 00 00 00 00 00 00 00 00 00 33 EE 00 00 33 88    ..........3...3.
01E9C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E9D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01E9E0:  00 00 00 00 00 00 20 F0 F0 F0 F0 F0 80 00 30 F0    ...... .......0.
01E9F0:  F0 E0 A0 A0 80 00 00 00 00 00 00 EE 77 FF 33 EE    ............w.3.
01EA00:  33 EE 33 EE 00 00 33 EE 00 00 00 00 00 00 33 88    3.3...3.......3.
01EA10:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01EA20:  77 FF 00 00 00 00 00 00 00 00 00 00 00 00 00 00    w...............
01EA30:  70 F0 F0 F0 F0 F0 80 00 10 F0 F0 E0 D0 D0 80 00    p...............
01EA40:  00 00 00 00 11 EE 77 00 77 77 77 77 77 77 00 00    ......w.wwwwww..
01EA50:  77 77 00 00 00 00 00 00 33 88 00 00 00 00 00 00    ww......3.......
01EA60:  00 00 00 00 00 00 00 00 00 00 77 00 00 00 00 00    ..........w.....
01EA70:  00 00 00 00 00 00 00 00 00 00 C0 F0 F0 F0 F0 F0    ................
01EA80:  80 00 00 F0 70 E0 F0 F0 80 00 00 00 00 00 30 E0    ....p.........0.
01EA90:  70 E0 00 70 00 70 70 70 00 00 70 00 33 EE 77 77    p..p.ppp..p.3.ww
01EAA0:  77 EE 77 EE 33 EE 77 EE 33 EE 77 77 00 00 00 00    w.w.3.w.3.ww....
01EAB0:  00 00 00 00 70 00 77 EE 33 EE 77 EE 33 EE 33 EE    ....p.w.3.w.3.3.
01EAC0:  00 00 00 00 E0 F0 F0 F0 F0 F0 80 00 00 70 F0 E0    .............p..
01EAD0:  F0 F0 00 00 00 00 00 00 60 E0 00 70 10 E0 00 E0    ........`..p....
01EAE0:  70 F0 00 00 70 00 70 70 70 70 70 77 30 80 70 70    p...p.pppppw0.pp
01EAF0:  70 70 00 70 70 70 00 00 00 00 00 00 00 00 70 E0    pp.ppp........p.
01EB00:  7E DD 77 19 E1 3E 01 CB 7E 20 0D 23 7E CB 7F 28    ~.w..>..~ .#~..(
01EB10:  07 E6 7F DD 77 06 18 53 DD 77 06 23 E5 7E F5 E6    ....w..S.w.#.~..
01EB20:  0F DD BE 05 28 06 DD 77 05 DD 72 0A 87 87 87 5F    ....(..w..r...._
01EB30:  21 42 64 19 50 59 ED A0 ED A0 ED A0 ED A0 ED A0    !Bd.PY..........
01EB40:  ED A0 ED A0 ED A0 F1 E1 E6 F0 28 1F FE F0 CA A0    ..........(.....
01EB50:  62 FE D0 CA BC 62 FE B0 CA C4 62 FE 80 D2 CC 62    b....b....b....b
01EB60:  FE 10 20 07 AF DD 77 1B DD 77 09 23 DD 75 00 DD    .. ...w..w.#.u..
01EB70:  74 01 DD 36 16 00 DD 36 17 20 DD 7E 17 B7 20 0E    t..6...6. .~.. .
01EB80:  DD 7E 15 B7 C8 DD 77 17 DD 7E 14 DD 77 16 16 00    .~....w..~..w...
01EB90:  DD 5E 16 DD 34 16 DD 35 17 DD 7E 1B B7 28 1A 67    .^..4..5..~..(.g
01EBA0:  DD 6E 1A 19 7E DD 46 07 80 87 42 4F 21 0C 63 09    .n..~.F...BO!.c.
01EBB0:  7E DD 77 18 23 7E DD 77 19 DD 66 0F DD 6E 0E 19    ~.w.#~.w..f..n..
01EBC0:  19 4E 23 46 DD 6E 18 DD 66 19 09 4D DD 7E 02 CD    .N#F.n..f..M.~..
01EBD0:  E4 62 4C DD 7E 03 CD E4 62 DD 66 11 DD 6E 10 19    .bL.~...b.f..n..
01EBE0:  7E CB 7F 20 12 E6 0F DD 96 0A 30 01 AF DD B6 09    ~.. ......0.....
01EBF0:  4F DD 7E 04 CD E4 62 DD 6E 12 DD 66 13 19 7E CB    O.~...b.n..f..~.
01EC00:  7F C0 E6 1F DD 46 0B 4F B7 78 28 08 47 79 32 CF    .....F.O.x(.Gy2.
01EC10:  60 78 D6 40 32 9B 62 3A C0 60 CB 47 32 C0 60 C9    `x.@2.b:.`.G2.`.
01EC20:  23 7E E5 87 06 00 4F 21 C2 64 09 5E 23 56 DD 73    #~....O!.d.^#V.s
01EC30:  1A DD 72 1B DD 36 09 00 E1 C3 EB 61 23 7E 32 BB    ..r..6.....a#~2.
01EC40:  60 C3 EB 61 23 7E DD 77 0A C3 EB 61 DD 36 09 10    `..a#~.w...a.6..
01EC50:  DD 36 1B 00 7E 0F 0F 0F 0F 32 ED 60 23 7E 32 DE    .6..~....2.`#~2.
01EC60:  60 C3 EB 61 06 F4 ED 79 06 F6 ED 78 F6 C0 ED 79    `..a...y...x...y
01EC70:  E6 3F ED 79 06 F4 ED 49 06 F6 4F F6 80 ED 79 ED    .?.y...I..O...y.
01EC80:  49 C9 FF FF FF FF 62 66 98 66 CE 66 EE 0E 18 0E    I.....bf.f.f....
01EC90:  4D 0D 8E 0C DA 0B 2F 0B 8F 0A F7 09 68 09 E1 08    M...../.....h...
01ECA0:  61 08 E9 07 77 07 0C 07 A7 06 47 06 ED 05 98 05    a...w.....G.....
01ECB0:  47 05 FC 04 B4 04 70 04 31 04 F4 03 BC 03 86 03    G.....p.1.......
01ECC0:  53 03 24 03 F6 02 CC 02 A4 02 7E 02 5A 02 38 02    S.$.......~.Z.8.
01ECD0:  18 02 FA 01 DE 01 C3 01 AA 01 92 01 7B 01 66 01    ............{.f.
01ECE0:  52 01 3F 01 2D 01 1C 01 0C 01 FD 00 EF 00 E1 00    R.?.-...........
01ECF0:  D5 00 C9 00 BE 00 B3 00 A9 00 9F 00 96 00 8E 00    ................
01ED00:  70 77 00 70 70 70 70 70 70 70 00 00 00 30 A0 F0    pw.ppppppp...0..
01ED10:  F0 F0 F0 F0 80 77 66 10 B0 E0 F0 F0 00 00 00 00    .....wf.........
01ED20:  00 00 70 F0 00 70 00 70 10 C0 70 70 00 00 70 00    ..p..p.p..pp..p.
01ED30:  70 70 70 70 70 00 30 80 70 F0 70 70 30 F0 70 70    ppppp.0.p.pp0.pp
01ED40:  00 00 00 00 00 00 00 00 70 00 70 00 30 F0 70 70    ........p.p.0.pp
01ED50:  70 00 70 F0 00 00 00 E0 E0 70 F0 F0 F0 F0 C0 FF    p.p......p......
01ED60:  FF 40 F0 E0 F0 E0 00 00 00 00 00 00 00 EE 77 77    .@............ww
01ED70:  77 77 33 88 77 77 00 00 77 77 77 77 77 77 77 00    ww3.ww..wwwwwww.
01ED80:  33 88 77 00 77 77 77 77 33 FF 00 00 00 00 00 00    3.w.wwww3.......
01ED90:  00 00 77 00 77 00 77 77 77 77 77 77 77 00 00 00    ..w.w.wwwwwww...
01EDA0:  00 80 00 70 F0 F0 F0 F0 C0 FF FF B8 10 F0 70 E0    ...p..........p.
01EDB0:  00 00 00 00 00 00 00 EE 33 EE 33 EE 77 FF 33 EE    ........3.3.w.3.
01EDC0:  00 00 33 EE 33 EE 33 FF 77 00 11 EE 33 EE 77 77    ..3.3.3.w...3.ww
01EDD0:  33 FF 00 77 00 00 00 00 00 00 00 00 77 00 77 00    3..w........w.w.
01EDE0:  33 FF 77 77 33 EE 33 EE 00 00 00 00 00 70 F0 F0    3.ww3.3......p..
01EDF0:  F0 F0 E0 55 FF B8 C0 70 70 C0 00 00 00 00 00 00    ...U...pp.......
01EE00:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01EE10:  00 00 00 00 00 00 00 00 00 00 00 00 33 EE 00 00    ............3...
01EE20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01EE30:  00 00 00 00 00 00 00 30 F0 F0 F0 F0 F0 91 FF B8    .......0........
01EE40:  F0 10 B0 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01EE50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01EE60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01EE70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01EE80:  00 10 F0 B0 F0 F0 F0 E0 FF B8 F0 00 00 00 00 00    ................
01EE90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01EEA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01EEB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01EEC0:  00 00 00 00 00 00 00 00 00 00 00 20 F0 B0 F0 B0    ........... ....
01EED0:  D0 20 FF 70 E0 00 00 00 00 00 00 00 00 00 00 00    . .p............
01EEE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01EEF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01EF00:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
01EF10:  1A 00 01 00 02 09 4E E5 1A 00 C1 02 00 00 00 02    ......N.........
01EF20:  1A 00 C6 02 00 00 00 02 1A 00 C2 02 00 00 00 02    ................
01EF30:  1A 00 C7 02 00 00 00 02 1A 00 C3 02 00 00 00 02    ................
01EF40:  1A 00 C8 02 00 00 00 02 1A 00 C4 02 00 00 00 02    ................
01EF50:  1A 00 C9 02 00 00 00 02 1A 00 C5 02 00 00 00 02    ................
01EF60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01EF70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01EF80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01EF90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01EFA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01EFB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01EFC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01EFD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01EFE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01EFF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01F000:  86 00 7F 00 77 00 71 00 6A 00 64 00 5F 00 59 00    ....w.q.j.d._.Y.
01F010:  54 00 50 00 4B 00 47 00 43 00 3F 00 3C 00 38 00    T.P.K.G.C.?.<.8.
01F020:  35 00 32 00 2F 00 2D 00 2A 00 28 00 26 00 24 00    5.2./.-.*.(.&.$.
01F030:  22 00 20 00 1E 00 1C 00 1B 00 19 00 18 00 16 00    ". .............
01F040:  15 00 14 00 13 00 12 00 11 00 10 00 0F 00 00 00    ................
01F050:  00 00 00 00 00 00 00 00 00 00 00 00 00 01 08 00    ................
01F060:  00 00 00 00 00 DF 00 00 00 00 00 00 00 00 00 00    ................
01F070:  00 00 00 00 00 00 00 00 02 03 09 00 00 00 00 00    ................
01F080:  00 E7 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01F090:  00 00 00 00 04 05 0A 00 00 00 00 00 00 EF 00 00    ................
01F0A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01F0B0:  00 00 00 00 00 00 00 00 53 54 2D 4D 6F 64 75 6C    ........ST-Modul
01F0C0:  65 2E E2 64 22 65 42 65 00 00 62 65 A2 65 C2 65    e..d"eBe..be.e.e
01F0D0:  10 10 E2 65 22 66 C2 65 08 00 DC 5E DC 5E DC 5E    ...e"f.e...^.^.^
01F0E0:  00 00 E2 65 42 66 C2 65 00 00 DC 5E DC 5E DC 5E    ...eBf.e...^.^.^
01F0F0:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
01F100:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
01F110:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
01F120:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
01F130:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
01F140:  00 00 DC 5E DC 5E DC 5E DC 5E DC 5E DC 5E DC 5E    ...^.^.^.^.^.^.^
01F150:  DC 5E DC 5E DC 5E DC 5E DC 5E DC 5E DC 5E DC 5E    .^.^.^.^.^.^.^.^
01F160:  DC 5E 80 00 00 01 80 01 00 02 80 02 00 03 00 04    .^..............
01F170:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01F180:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01F190:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01F1A0:  00 00 0D 0D 0C 0C 0B 0A 00 00 00 00 00 00 00 00    ................
01F1B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01F1C0:  00 00 06 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01F1D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01F1E0:  00 00 01 00 01 00 01 00 01 00 00 00 00 00 00 00    ................
01F1F0:  00 00 01 00 01 00 01 00 01 00 00 00 00 00 00 00    ................
01F200:  2F 82 28 02 00 2F 02 02 2A 82 31 82 2A 02 00 31    /.(../..*.1.*..1
01F210:  02 02 2A 82 31 82 2A 02 00 31 02 02 2D 82 34 82    ..*.1.*..1..-.4.
01F220:  2D 02 00 34 02 02 2D 82 34 82 FF 2F 02 00 27 02    -..4..-.4../..'.
01F230:  02 23 82 2F 82 23 02 00 2F 02 02 23 82 2F 82 23    .#./.#../..#./.#
01F240:  02 00 2F 02 02 28 82 34 82 28 02 00 34 02 02 28    ../..(.4.(..4..(
01F250:  82 34 82 28 02 00 34 02 02 25 82 31 82 25 02 00    .4.(..4..%.1.%..
01F260:  31 02 02 25 82 31 82 25 02 00 31 02 02 23 82 2F    1..%.1.%..1..#./
01F270:  82 23 02 00 2F 02 02 23 02 00 2F 02 02 FF 23 02    .#../..#../...#.
01F280:  00 2F 02 02 28 82 2F 82 28 02 00 2F 02 02 28 82    ./..(./.(../..(.
01F290:  2F 82 28 02 00 2F 02 02 2C 82 33 82 2C 02 00 33    /.(../..,.3.,..3
01F2A0:  02 02 2C 82 33 82 2C 02 00 33 02 02 27 82 2F 82    ..,.3.,..3..'./.
01F2B0:  27 02 00 2F 02 02 27 82 2F 82 27 02 00 2F 02 02    '../..'./.'../..
01F2C0:  28 82 2F 82 28 02 00 2F 02 02 28 82 2F 82 FF 2F    (./.(../..(./../
01F2D0:  02 00 28 02 02 D3 B1 02 D3 B1 02 D3 B1 02 D3 B1    ..(.............
01F2E0:  02 D3 B1 03 D3 B1 03 D3 B1 03 D3 B1 04 D3 B1 04    ................
01F2F0:  D3 B1 04 D3 B1 05 D3 B1 05 D3 B1 05 D3 B1 06 D3    ................
01F300:  B1 06 D3 B1 06 D0 B1 02 D0 B1 02 D0 B1 02 D0 B1    ................
01F310:  02 D0 B1 03 D0 B1 03 D0 B1 03 D0 B1 03 D0 B1 04    ................
01F320:  D0 B1 04 D0 B1 04 D0 B1 04 D0 B1 05 D0 B1 05 D0    ................
01F330:  B1 05 D0 B1 05 D3 B1 02 D3 B1 02 D3 B1 02 D3 B1    ................
01F340:  02 D3 B1 03 D3 B1 03 D3 B1 03 D3 B1 03 D3 B1 04    ................
01F350:  D3 B1 04 D3 B1 04 D3 B1 04 D3 B1 05 D3 B1 05 D3    ................
01F360:  B1 05 D3 B1 05 D0 B1 02 D0 B1 02 D0 B1 02 D0 B1    ................
01F370:  02 D0 B1 03 D0 B1 03 D0 B1 03 D0 B1 03 D0 B1 04    ................
01F380:  D0 B1 04 D0 B1 04 D0 B1 05 FF 23 02 B0 02 2F 02    ..........#.../.
01F390:  02 28 82 2F 82 28 02 00 2F 02 02 28 82 2F 82 28    .(./.(../..(./.(
01F3A0:  02 00 2F 02 02 2C 82 33 82 2C 02 00 33 02 02 2C    ../..,.3.,..3..,
01F3B0:  82 33 82 2C 02 00 33 02 02 27 82 2F 82 27 02 00    .3.,..3..'./.'..
01F3C0:  2F 02 02 27 82 2F 82 27 02 00 2F 02 02 28 82 2F    /..'./.'../..(./
01F3D0:  82 28 02 00 2F 02 02 28 82 2F 82 FF 00 04 3B 04    .(../..(./....;.
01F3E0:  B1 02 3F 04 01 42 84 47 84 44 84 42 84 40 84 3F    ..?..B.G.D.B.@.?
01F3F0:  84 3D 84 40 84 44 84 47 84 46 84 44 84 42 84 FF    .=.@.D.G.F.D.B..
01F400:  00 00 01 00 01 00 01 00 01 00 00 00 00 00 00 00    ................
01F410:  00 00 01 00 01 00 01 00 01 00 00 00 00 00 00 00    ................
01F420:  00 00 0B 0D 0C 0B 80 80 80 80 80 80 80 80 80 80    ................
01F430:  80 80 80 80 80 80 80 80 80 80 80 80 80 80 80 80    ................
01F440:  80 80 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01F450:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01F460:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01F470:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01F480:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01F490:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01F4A0:  00 00 0C 0D 0C 0B 0A 09 09 09 09 09 09 09 09 09    ................
01F4B0:  09 09 09 09 09 09 09 09 08 07 06 05 04 03 02 01    ................
01F4C0:  00 00 08 09 0A 0B 0B 0C 0C 0C 0B 0A 0A 09 09 08    ................
01F4D0:  08 07 06 06 06 08 07 09 08 09 08 09 08 09 08 09    ................
01F4E0:  08 09 00 04 67 00 22 67 00 46 67 00 79 67 00 AD    ....g."g.Fg.yg..
01F4F0:  67 00 CF 67 00 F5 67 00 1D 68 00 39 68 00 69 68    g..g..g..h.9h.ih
01F500:  00 8B 68 00 A9 68 00 CD 68 00 ED 68 00 D2 69 00    ..h..h..h..h..i.
01F510:  11 69 00 CD 68 80 62 66 00 89 6A 00 D8 6A 00 29    .i..h.bf..j..j.)
01F520:  6B 00 7A 6B 00 CB 6B 00 1A 6C 00 69 6C 00 BA 6C    k.zk..k..l.il..l
01F530:  00 09 6D 00 5A 6D 00 89 6A 00 AB 6D 00 FE 6D 00    ..m.Zm..j..m..m.
01F540:  4F 6E 00 0A 6F 00 0A 6F 00 FE 6D 80 98 66 00 5C    On..o..o..m..f.\
01F550:  6F 00 80 6F 00 A4 6F 00 20 70 00 9C 70 00 DD 70    o..o..o. p..p..p
01F560:  00 20 71 00 9C 71 00 D7 71 00 FB 71 00 1E 72 00    . q..q..q..q..r.
01F570:  9A 72 00 1C 73 00 45 73 00 2A 74 00 69 73 00 1C    .r..s.Es.*t.is..
01F580:  73 80 CE 66 47 02 01 49 82 4B 86 4E 86 4B 84 4E    s..fG..I.K.N.K.N
01F590:  86 50 86 47 82 49 82 4B 86 49 86 47 84 50 86 4E    .P.G.I.K.I.G.P.N
01F5A0:  86 FF 47 02 01 49 82 4B 86 4E 86 4B 84 4E 86 50    ..G..I.K.N.K.N.P
01F5B0:  86 4E 84 57 84 57 02 02 55 06 01 55 02 02 53 82    .N.W.W..U..U..S.
01F5C0:  55 06 01 53 86 FF 00 04 58 04 02 58 82 57 84 57    U..S....X..X.W.W
01F5D0:  82 55 82 53 82 55 82 53 82 50 82 53 06 01 50 02    .U.S.U.S.P.S..P.
01F5E0:  02 D3 02 D5 02 57 84 57 82 55 06 01 55 02 02 53    .....W.W.U..U..S
01F5F0:  82 55 86 53 04 01 4E 82 FF 53 02 01 4E 82 58 04    .U.S..N..S..N.X.
01F600:  40 04 B1 02 3B 04 01 3F 84 42 84 47 84 44 84 42    @...;..?.B.G.D.B
01F610:  84 40 84 3F 84 3D 84 40 84 3F 84 3D 84 3B 84 42    .@.?.=.@.?.=.;.B
01F620:  84 3B 84 FF 00 04 BB B1 02 BB 01 BB 01 BB 01 BD    .;..............
01F630:  01 BD 01 BD 01 BD 01 BF 01 BF 01 BF 01 BF 01 C0    ................
01F640:  01 C0 01 C0 01 C0 01 BF 01 BF 01 BF 01 BF 01 BD    ................
01F650:  01 BD 01 BD 01 BD 01 BF 01 BF 01 BF 01 BF 01 BB    ................
01F660:  01 BB 01 BB 01 BB 01 BB 01 BB 01 BB 01 BB 01 BD    ................
01F670:  01 BD 01 BD 01 BD 01 BF 01 BF 01 BF 01 BF 01 C0    ................
01F680:  01 C0 01 C0 01 C0 01 BF 01 BF 01 BF 01 BF 01 BD    ................
01F690:  01 BD 01 BD 01 BD 01 BB 01 BB 01 BB 01 BB 01 FF    ................
01F6A0:  00 04 BB B1 03 BB 01 BB 01 BB 01 BD 01 BD 01 BD    ................
01F6B0:  01 BD 01 BF 01 BF 01 BF 01 BF 01 C0 01 C0 01 C0    ................
01F6C0:  01 C0 01 BF 01 BF 01 BF 01 BF 01 BD 01 BD 01 BD    ................
01F6D0:  01 BD 01 BF 01 BF 01 BF 01 BF 01 BB 01 BB 01 BB    ................
01F6E0:  01 BB 01 BB 01 BB 01 BB 01 BB 01 BD 01 BD 01 BD    ................
01F6F0:  01 BD 01 BF 01 BF 01 BF 01 BF 01 C0 01 C0 01 C0    ................
01F700:  01 C0 01 BF 01 BF 01 BF 01 BF 01 C2 01 C2 01 C2    ................
01F710:  01 C2 01 C7 01 C7 01 C7 01 C7 01 FF 00 04 BB B1    ................
01F720:  02 3B 03 01 BF 01 3F 83 C2 01 42 83 C7 01 47 83    .;....?...B...G.
01F730:  C4 01 44 83 C2 01 42 83 C0 01 40 83 BF 01 3F 83    ..D...B...@...?.
01F740:  BD 01 3D 83 C0 01 40 83 C4 01 44 83 C7 01 47 83    ..=...@...D...G.
01F750:  C6 01 46 83 C4 01 44 83 C2 01 42 83 FF C0 B1 02    ..F...D...B.....
01F760:  40 03 01 BB 01 3B 83 BF 01 3F 83 C2 01 42 83 C7    @....;...?...B..
01F770:  01 47 83 C4 01 44 83 C2 01 42 83 C0 01 40 83 BF    .G...D...B...@..
01F780:  01 3F 83 BD 01 3D 83 C0 01 40 83 BF 01 3F 83 BD    .?...=...@...?..
01F790:  01 3D 83 BB 01 3B 83 C2 01 42 83 BB 01 3B 83 FF    .=...;...B...;..
01F7A0:  00 04 C2 B2 03 C2 02 C2 02 C2 02 C0 02 C0 02 C0    ................
01F7B0:  02 C0 02 BF 02 BF 02 BF 02 BF 02 BD 02 BD 02 BD    ................
01F7C0:  02 BD 02 C0 02 C0 02 C0 02 C0 02 BF 02 BF 02 BF    ................
01F7D0:  02 BF 02 BB 02 BB 02 BB 02 BB 02 B6 02 B6 02 B6    ................
01F7E0:  02 B6 02 B8 02 B8 02 B8 02 B8 02 BB 02 BB 02 BB    ................
01F7F0:  02 BB 02 BD 02 BD 02 BD 02 BD 02 BF 02 BF 02 BF    ................
01F800:  02 58 82 57 84 57 82 55 82 53 82 55 82 53 82 50    .X.W.W.U.S.U.S.P
01F810:  82 53 06 01 50 02 02 D3 02 D5 02 57 84 57 82 55    .S..P......W.W.U
01F820:  06 01 55 02 02 53 82 55 86 53 06 01 FF 47 02 01    ..U..S.U.S...G..
01F830:  49 02 02 4B 06 01 4E 86 4B 84 4E 86 50 86 47 82    I..K..N.K.N.P.G.
01F840:  49 02 02 4B 06 01 49 86 47 84 50 86 4E 86 FF 47    I..K..I.G.P.N..G
01F850:  02 01 49 02 02 4B 06 01 4E 86 4B 84 4E 86 50 86    ..I..K..N.K.N.P.
01F860:  4E 84 57 84 57 02 02 55 06 01 55 82 53 02 02 55    N.W.W..U..U.S..U
01F870:  06 01 53 86 FF 00 04 4E 04 01 52 82 55 84 52 82    ..S....N..R.U.R.
01F880:  4E 82 53 86 4E 84 4B 02 02 4E 06 01 50 84 4E 84    N.S.N.K..N..P.N.
01F890:  4C 02 02 4B 04 01 4B 84 49 84 47 86 FF 47 02 01    L..K..K.I.G..G..
01F8A0:  49 82 4B 86 4C 86 4E 84 4E 86 4C 86 4B 84 49 86    I.K.L.N.N.L.K.I.
01F8B0:  47 86 49 84 4B 8A 47 82 FF 49 02 01 4B 82 4C 82    G.I.K.G..I..K.L.
01F8C0:  4B 82 49 82 47 84 49 84 4B 8C 47 82 49 82 4B 82    K.I.G.I.K.G.I.K.
01F8D0:  4C 82 4B 82 49 82 47 84 49 02 02 4E 82 4E 06 01    L.K.I.G.I..N.N..
01F8E0:  4C 02 02 4B 04 01 49 82 FF 00 02 47 0C 01 42 82    L..K..I....G..B.
01F8F0:  47 82 49 82 47 8A 42 82 47 82 49 82 4B 84 49 82    G.I.G.B.G.I.K.I.
01F900:  47 82 46 82 47 84 4B 88 49 86 FF 47 02 01 49 82    G.F.G.K.I..G..I.
01F910:  4B 86 4E 86 4B 84 4E 86 50 86 47 82 49 82 4B 86    K.N.K.N.P.G.I.K.
01F920:  49 86 47 84 50 86 4E 86 FF 47 02 01 49 82 4B 86    I.G.P.N..G..I.K.
01F930:  4E 86 4B 84 4E 86 50 86 4E 84 57 84 57 02 02 55    N.K.N.P.N.W.W..U
01F940:  06 01 55 02 02 53 02 01 55 86 53 86 FF 00 04 4B    ..U..S..U.S....K
01F950:  04 01 4B 02 02 49 04 01 49 82 47 84 4B 86 47 8A    ..K..I..I.G.K.G.
01F960:  4B 84 4B 82 49 84 49 82 47 82 44 8E FF 00 05 4B    K.K.I.I.G.D....K
01F970:  04 B4 01 4B 02 04 49 84 49 82 47 84 4B 86 47 88    ...K..I.I.G.K.G.
01F980:  4E 82 4E 82 4C 82 4B 82 49 84 4B 82 47 84 44 8B    N.N.L.K.I.K.G.D.
01F990:  FF D0 B1 05 D0 B1 05 D0 B1 05 D0 B1 05 D3 B1 02    ................
01F9A0:  D3 B1 02 D3 B1 02 D3 B1 02 D3 B1 03 D3 B1 03 D3    ................
01F9B0:  B1 03 D3 B1 04 D3 B1 04 D3 B1 04 D3 B1 05 D3 B1    ................
01F9C0:  05 D3 B1 05 D3 B1 06 D3 B1 06 D3 B1 06 D0 B1 02    ................
01F9D0:  D0 B1 02 D0 B1 02 D0 B1 02 D0 B1 03 D0 B1 03 D0    ................
01F9E0:  B1 03 D0 B1 03 D0 B1 04 D0 B1 04 D0 B1 04 D0 B1    ................
01F9F0:  04 D0 B1 05 D0 B1 05 D0 B1 05 D0 B1 05 D3 B1 02    ................
01FA00:  02 BF 02 BF 02 BF 02 BF 02 BF 02 C0 02 C0 02 C0    ................
01FA10:  02 C0 02 BB 02 BB 02 BB 02 BB 02 FF 47 02 B2 00    ............G...
01FA20:  46 02 02 47 82 42 84 C2 02 42 05 01 47 02 02 46    F..G.B...B..G..F
01FA30:  82 47 82 42 84 C4 02 44 05 01 47 02 02 46 82 47    .G.B...D..G..F.G
01FA40:  82 42 84 C2 02 42 05 01 47 02 02 46 82 47 82 42    .B...B..G..F.G.B
01FA50:  84 C4 02 44 05 01 FF 42 02 01 47 82 49 84 47 82    ...D...B..G.I.G.
01FA60:  42 82 47 82 42 84 44 8E 42 82 47 82 49 84 47 82    B.G.B.D.B.G.I.G.
01FA70:  42 82 47 82 42 84 49 88 47 86 FF 42 02 01 47 02    B.G.B.I.G..B..G.
01FA80:  02 49 04 01 47 82 42 82 47 82 42 84 4B 8E 4E 82    .I..G.B.G.B.K.N.
01FA90:  4E 86 4C 82 4B 86 4C 83 4B 08 04 49 85 FF 00 04    N.L.K.L.K..I....
01FAA0:  BB B2 03 BB 02 BB 02 BB 02 BF 02 BF 02 BF 02 BF    ................
01FAB0:  02 C2 02 C2 02 C2 02 C2 02 C7 02 C7 02 C7 02 C7    ................
01FAC0:  02 C4 02 C4 02 C4 02 C4 02 C2 02 C2 02 C2 02 C2    ................
01FAD0:  02 C0 02 C0 02 C0 02 C0 02 BF 02 BF 02 BF 02 BF    ................
01FAE0:  02 BD 02 BD 02 BD 02 BD 02 C0 02 C0 02 C0 02 C0    ................
01FAF0:  02 C4 02 C4 02 C4 02 C4 02 C7 02 C7 02 C7 02 C7    ................
01FB00:  02 C6 02 C6 02 C6 02 C6 02 C4 02 C4 02 C4 02 C4    ................
01FB10:  02 C2 02 C2 02 C2 02 C2 02 FF C0 B2 03 C0 02 C0    ................
01FB20:  02 C0 02 BB 02 BB 02 BB 02 BB 02 BF 02 BF 02 BF    ................
01FB30:  02 BF 02 C2 02 C2 02 C2 02 C2 02 C7 02 C7 02 C7    ................
01FB40:  02 C7 02 C4 02 C4 02 C4 02 C4 02 C2 02 C2 02 C2    ................
01FB50:  02 C2 02 C0 02 C0 02 C0 02 C0 02 BF 02 BF 02 BF    ................
01FB60:  02 BF 02 BD 02 BD 02 BD 02 BD 02 C0 02 C0 02 C0    ................
01FB70:  02 C0 02 BF 02 BF 02 BF 02 BF 02 BD 02 BD 02 BD    ................
01FB80:  02 BD 02 BB 02 BB 02 BB 02 BB 02 C2 02 C2 02 C2    ................
01FB90:  02 C2 02 BB 02 BB 02 BB 02 BB 02 FF 47 04 01 44    ............G..D
01FBA0:  04 02 42 82 47 84 42 82 44 84 42 82 47 84 42 82    ..B.G.B.D.B.G.B.
01FBB0:  44 84 42 82 4E 82 4E 82 4C 82 4B 82 49 84 4B 82    D.B.N.N.L.K.I.K.
01FBC0:  47 82 44 8E FF 00 04 4B 04 B1 01 4B 02 01 49 84    G.D....K...K..I.
01FBD0:  49 82 47 84 4B 86 47 88 4E 82 4E 82 4C 82 4B 82    I.G.K.G.N.N.L.K.
01FBE0:  49 84 4B 82 47 84 44 8C FF D0 B1 05 D0 B1 05 D0    I.K.G.D.........
01FBF0:  B1 05 D0 B1 05 D3 B1 02 D3 B1 02 D3 B1 02 D3 B1    ................
01FC00:  D3 B1 02 D3 B1 02 D3 B1 02 D3 B1 03 D3 B1 03 D3    ................
01FC10:  B1 03 D3 B1 03 D3 B1 04 D3 B1 04 D3 B1 04 D3 B1    ................
01FC20:  04 D3 B1 05 D3 B1 05 D3 B1 05 D3 B1 05 D0 B1 02    ................
01FC30:  D0 B1 02 D0 B1 02 D0 B1 02 D0 B1 03 D0 B1 03 D0    ................
01FC40:  B1 03 D0 B1 03 D0 B1 04 D0 B1 04 D0 B1 04 D0 B1    ................
01FC50:  05 FF 00 04 D3 B1 02 D3 B1 02 D3 B1 02 D3 B1 02    ................
01FC60:  D3 B1 03 D3 B1 03 D3 B1 03 D3 B1 04 D3 B1 04 D3    ................
01FC70:  B1 04 D3 B1 05 D3 B1 05 D3 B1 05 D3 B1 06 D3 B1    ................
01FC80:  06 D3 B1 06 D0 B1 02 D0 B1 02 D0 B1 02 D0 B1 02    ................
01FC90:  D0 B1 03 D0 B1 03 D0 B1 03 D0 B1 03 D0 B1 04 D0    ................
01FCA0:  B1 04 D0 B1 04 D0 B1 04 D0 B1 05 D0 B1 05 D0 B1    ................
01FCB0:  05 D0 B1 05 D3 B1 02 D3 B1 02 D3 B1 02 D3 B1 02    ................
01FCC0:  D3 B1 03 D3 B1 03 D3 B1 03 D3 B1 03 D3 B1 04 D3    ................
01FCD0:  B1 04 D3 B1 04 D3 B1 04 D3 B1 05 D3 B1 05 D3 B1    ................
01FCE0:  05 D3 B1 05 D0 B1 02 D0 B1 02 D0 B1 02 D0 B1 02    ................
01FCF0:  D0 B1 03 D0 B1 03 D0 B1 03 D0 B1 03 D0 B1 04 D0    ................
01FD00:  B1 04 D0 B1 04 D0 B1 05 FF 23 04 00 23 02 02 2F    .........#..#../
01FD10:  82 23 02 00 2F 02 02 23 82 2F 82 23 02 00 2F 02    .#../..#./.#../.
01FD20:  02 28 82 34 82 28 02 00 34 02 02 28 82 34 82 28    .(.4.(..4..(.4.(
01FD30:  02 00 34 02 02 25 82 31 82 25 02 00 31 02 02 25    ..4..%.1.%..1..%
01FD40:  82 31 82 25 02 00 31 02 02 2A 82 36 82 2A 02 00    .1.%..1..*.6.*..
01FD50:  36 02 02 2A 82 36 82 FF 2E 04 00 23 02 02 2F 82    6..*.6.....#../.
01FD60:  23 02 00 2F 02 02 23 82 2F 82 23 02 00 2F 02 02    #../..#./.#../..
01FD70:  28 82 34 82 28 02 00 34 02 02 28 82 34 82 28 02    (.4.(..4..(.4.(.
01FD80:  00 34 02 02 25 82 31 82 25 02 00 31 02 02 25 82    .4..%.1.%..1..%.
01FD90:  31 82 25 02 00 31 02 02 23 82 2F 82 23 02 00 2F    1.%..1..#./.#../
01FDA0:  02 02 23 02 00 2F 02 02 FF 2F 02 00 3B 02 02 34    ..#../.../..;..4
01FDB0:  82 40 82 34 02 00 40 02 02 34 82 40 82 34 02 00    .@.4..@..4.@.4..
01FDC0:  40 02 02 31 82 3D 82 31 02 00 3D 02 02 31 82 3D    @..1.=.1..=..1.=
01FDD0:  82 31 02 00 3D 02 02 36 82 42 82 36 02 00 42 02    .1..=..6.B.6..B.
01FDE0:  02 36 82 42 82 36 02 00 42 02 02 2F 82 3B 82 2F    .6.B.6..B../.;./
01FDF0:  02 00 3B 02 02 2F 82 3B 82 FF 2F 02 00 3B 02 02    ..;../.;../..;..
01FE00:  02 D3 B1 03 D3 B1 03 D3 B1 03 D3 B1 04 D3 B1 04    ................
01FE10:  D3 B1 04 D3 B1 05 D3 B1 05 D3 B1 05 D3 B1 06 D3    ................
01FE20:  B1 06 D3 B1 06 D0 B1 02 D0 B1 02 D0 B1 02 D0 B1    ................
01FE30:  02 D0 B1 03 D0 B1 03 D0 B1 03 D0 B1 03 D0 B1 04    ................
01FE40:  D0 B1 04 D0 B1 04 D0 B1 04 D0 B1 05 D0 B1 05 D0    ................
01FE50:  B1 05 D0 B1 05 D7 B1 02 D7 B1 02 D7 B1 02 D7 B1    ................
01FE60:  02 D7 B1 03 D7 B1 03 D7 B1 03 D7 B1 03 D7 B1 04    ................
01FE70:  D7 B1 04 D7 B1 04 D7 B1 04 D7 B1 05 D7 B1 05 D7    ................
01FE80:  B1 05 D7 B1 05 D3 B1 02 D3 B1 02 D3 B1 02 D3 B1    ................
01FE90:  02 D3 B1 03 D3 B1 03 D3 B1 03 D3 B1 03 D3 B1 04    ................
01FEA0:  D3 B1 04 D3 B1 04 D3 B1 05 FF 00 04 D3 B1 02 D3    ................
01FEB0:  B1 02 D3 B1 02 D3 B1 02 D3 B1 03 D3 B1 03 D3 B1    ................
01FEC0:  03 D3 B1 04 D3 B1 04 D3 B1 04 D3 B1 05 D3 B1 05    ................
01FED0:  D3 B1 05 D3 B1 06 D3 B1 06 D3 B1 06 D0 B1 02 D0    ................
01FEE0:  B1 02 D0 B1 02 D0 B1 02 D0 B1 03 D0 B1 03 D0 B1    ................
01FEF0:  03 D0 B1 03 D0 B1 04 D0 B1 04 D0 B1 04 D0 B1 04    ................
01FF00:  D0 B1 05 D0 B1 05 D0 B1 05 D0 B1 05 D3 B1 02 D3    ................
01FF10:  B1 02 D3 B1 02 D3 B1 02 D3 B1 03 D3 B1 03 D3 B1    ................
01FF20:  03 D3 B1 03 D3 B1 04 D3 B1 04 D3 B1 04 D3 B1 04    ................
01FF30:  D3 B1 05 D3 B1 05 D3 B1 05 D3 B1 05 D0 B1 02 D0    ................
01FF40:  B1 02 D0 B1 02 D0 B1 02 D0 B1 03 D0 B1 03 D0 B1    ................
01FF50:  03 D0 B1 03 D0 B1 04 D0 B1 04 D0 B1 04 D0 B1 05    ................
01FF60:  FF 1A 00 00 00 00 00 53 54 00 00 00 00 00 00 00    .......ST.......
01FF70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
01FF80:  02 BD 02 BB 02 BB 02 BB 02 BB 02 C2 02 C2 02 C2    ................
01FF90:  02 C2 02 BB 02 BB 02 BB 02 BB 02 FF 47 04 01 44    ............G..D
01FFA0:  04 02 42 82 47 84 42 82 44 84 42 82 47 84 42 82    ..B.G.B.D.B.G.B.
01FFB0:  44 84 42 82 4E 82 4E 82 4C 82 4B 82 49 84 4B 82    D.B.N.N.L.K.I.K.
01FFC0:  47 82 44 8E FF 00 04 4B 04 B1 01 4B 02 01 49 84    G.D....K...K..I.
01FFD0:  49 82 47 84 4B 86 47 88 4E 82 4E 82 4C 82 4B 82    I.G.K.G.N.N.L.K.
01FFE0:  49 84 4B 82 47 84 44 8C FF D0 B1 05 D0 B1 05 D0    I.K.G.D.........
01FFF0:  B1 05 D0 B1 05 D3 B1 02 D3 B1 02 D3 B1 02 D3 B1    ................
020000:  34 82 40 82 34 02 00 40 02 02 34 82 40 82 34 02    4.@.4..@..4.@.4.
020010:  00 40 02 02 31 82 3D 82 31 02 00 3D 02 02 31 82    .@..1.=.1..=..1.
020020:  3D 82 31 02 00 3D 02 02 36 82 42 82 36 02 00 42    =.1..=..6.B.6..B
020030:  02 02 36 82 42 82 36 02 00 42 02 02 2F 82 3B 82    ..6.B.6..B../.;.
020040:  2F 02 00 3B 02 02 2F 82 3B 82 FF 23 04 00 23 02    /..;../.;..#..#.
020050:  02 2A 82 23 02 00 2A 02 02 23 82 2A 82 23 02 00    .*.#..*..#.*.#..
020060:  2A 02 02 28 82 2F 82 28 02 00 2F 02 02 28 82 2F    *..(./.(../..(./
020070:  82 28 02 00 2F 02 02 25 82 2C 82 25 02 00 2C 02    .(../..%.,.%..,.
020080:  02 25 82 2C 82 25 02 00 2C 02 02 2A 82 31 82 2A    .%.,.%..,..*.1.*
020090:  02 00 31 02 02 2A 82 31 82 FF 23 04 00 23 02 02    ..1..*.1..#..#..
0200A0:  2A 82 23 02 00 2A 02 02 23 82 2A 82 23 02 00 2A    *.#..*..#.*.#..*
0200B0:  02 02 28 82 2F 82 28 02 00 2F 02 02 28 82 2F 82    ..(./.(../..(./.
0200C0:  28 02 00 2F 02 02 25 82 2C 82 25 02 00 2C 02 02    (../..%.,.%..,..
0200D0:  25 82 2C 82 25 02 00 2C 02 02 23 82 2A 82 23 02    %.,.%..,..#.*.#.
0200E0:  00 2A 02 02 23 82 2A 82 FF 2A 02 00 36 02 02 2A    .*..#.*..*..6..*
0200F0:  82 31 82 2A 02 00 31 02 02 2A 82 31 82 2A 02 00    .1.*..1..*.1.*..
020100:  31 02 02 23 82 2A 82 23 02 00 2A 02 02 23 82 2A    1..#.*.#..*..#.*
020110:  82 23 02 00 2A 02 02 28 82 2F 82 28 02 00 2F 02    .#..*..(./.(../.
020120:  02 28 82 2F 82 28 02 00 2F 02 02 25 82 2C 82 25    .(./.(../..%.,.%
020130:  02 00 2C 02 02 25 82 2C 82 FF 23 04 00 23 02 02    ..,..%.,..#..#..
020140:  2A 82 23 02 00 2A 02 02 23 82 2A 82 23 02 00 2A    *.#..*..#.*.#..*
020150:  02 02 28 82 2F 82 28 02 00 2F 02 02 28 82 2F 82    ..(./.(../..(./.
020160:  28 02 00 2F 02 02 2A 82 31 82 2A 02 00 31 02 02    (../..*.1.*..1..
020170:  2A 82 31 82 2A 02 00 31 02 02 2C 82 33 82 2C 02    *.1.*..1..,.3.,.
020180:  00 33 02 02 2C 82 33 82 FF 2C 02 00 33 02 02 27    .3..,.3..,..3..'
020190:  82 2F 82 27 02 00 2F 02 02 27 82 2F 82 27 02 00    ./.'../..'./.'..
0201A0:  2F 02 02 28 82 2F 82 28 02 00 2F 02 02 28 82 2F    /..(./.(../..(./
0201B0:  82 28 02 00 2F 02 02 2A 82 31 82 2A 02 00 31 02    .(../..*.1.*..1.
0201C0:  02 2A 82 31 82 2A 02 00 31 02 02 2C 82 33 82 2C    .*.1.*..1..,.3.,
0201D0:  02 00 33 02 02 2C 82 33 82 FF 2C 02 00 33 02 02    ..3..,.3..,..3..
0201E0:  27 82 2F 82 27 02 00 2F 02 02 27 82 2F 82 27 02    './.'../..'./.'.
0201F0:  00 2F 02 02 28 82 2F 82 28 02 00 2F 02 02 28 82    ./..(./.(../..(.
020200:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
020210:  1B 00 01 00 02 09 4E E5 1B 00 C1 02 00 00 00 02    ......N.........
020220:  1B 00 C6 02 00 00 00 02 1B 00 C2 02 00 00 00 02    ................
020230:  1B 00 C7 02 00 00 00 02 1B 00 C3 02 00 00 00 02    ................
020240:  1B 00 C8 02 00 00 00 02 1B 00 C4 02 00 00 00 02    ................
020250:  1B 00 C9 02 00 00 00 02 1B 00 C5 02 00 00 00 02    ................
020260:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
020270:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
020280:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
020290:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0202A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0202B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0202C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0202D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0202E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0202F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
020300:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
020310:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
020320:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
020330:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
020340:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
020350:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
020360:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
020370:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
020380:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
020390:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0203A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0203B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0203C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0203D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0203E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0203F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
020400:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
020410:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
020420:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
020430:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
020440:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
020450:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
020460:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
020470:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
020480:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
020490:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0204A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0204B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0204C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0204D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0204E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0204F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
020500:  00 59 45 53 4F 44 20 20 20 4D 55 53 00 00 00 00    .YESOD   MUS....
020510:  00 00 02 00 00 00 60 00 8C 1C 00 60 00 00 00 00    ......`....`....
020520:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
020530:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
020540:  8C 1C 00 EB 04 04 C0 03 DC B3 04 C0 03 DC B3 04    ................
020550:  FF 1A FF 00 FF 20 00 75 30 00 00 00 00 00 00 00    ..... .u0.......
020560:  B7 3B 0B 24 00 00 66 20 00 75 30 00 00 00 00 00    .;.$..f .u0.....
020570:  00 00 B7 3B 0B 1A 3B 00 00 00 00 00 00 00 67 3B    ...;..;.......g;
020580:  C3 0B 60 C3 93 60 C3 77 60 66 04 06 03 DD 21 DA    ..`..`.w`f....!.
020590:  63 FD 21 06 63 11 1C 00 C5 DD 36 06 01 DD 72 09    c.!.c.....6...r.
0205A0:  DD 72 1B DD 36 05 10 FD 6E 00 FD 66 01 7E DD 77    .r..6...n..f.~.w
0205B0:  08 23 4E 23 46 23 DD 75 0C DD 74 0D DD 71 00 DD    .#N#F#.u..t..q..
0205C0:  70 01 DD 19 FD 23 FD 23 C1 10 CD 3E 07 32 BB 60    p....#.#...>.2.`
0205D0:  7A 32 CF 60 3C 32 B6 60 3E 38 32 C0 60 3E FF 32    z2.`<2.`>82.`>.2
0205E0:  02 63 32 03 63 32 04 63 32 05 63 3E 0C 4A CD E4    .c2.c2.c2.c>.J..
0205F0:  62 3E 0D 4A C3 E4 62 3E 07 0E 3F CD E4 62 3E 08    b>.J..b>..?..b>.
020600:  0E 00 CD E4 62 3E 09 0E 00 CD E4 62 3E 0A 0E 00    ....b>.....b>...
020610:  C3 E4 62 21 B6 60 35 DD 21 DA 63 01 E8 63 CD 49    ..b!.`5.!.c..c.I
020620:  61 DD 21 F6 63 01 04 64 CD 49 61 DD 21 12 64 01    a.!.c..d.Ia.!.d.
020630:  20 64 CD 49 61 3E 00 B7 20 05 3E 00 32 B6 60 3E     d.Ia>.. .>.2.`>
020640:  00 21 03 63 BE 28 07 77 4F 3E 07 CD E4 62 3E 00    .!.c.(.wO>...b>.
020650:  21 02 63 BE 28 07 77 4F 3E 06 CD E4 62 3E 00 21    !.c.(.wO>...b>.!
020660:  04 63 BE 28 07 77 4F 3E 0B CD E4 62 3E 00 21 05    .c.(.wO>...b>.!.
020670:  63 BE C8 77 4F 3E 0D C3 E4 62 23 46 DD 70 06 23    c..wO>...b#F.p.#
020680:  DD 75 00 DD 74 01 C3 FA 61 23 7E DD 77 06 23 DD    .u..t...a#~.w.#.
020690:  75 00 DD 74 01 AF DD 77 17 DD 77 15 4F DD 7E 04    u..t...w..w.O.~.
0206A0:  C3 E4 62 DD 36 0A 00 DD 6E 0C DD 66 0D 7E FE 80    ..b.6...n..f.~..
0206B0:  20 06 23 5E 23 56 EB 7E 23 5E 23 56 23 DD 75 0C     .#^#V.~#^#V#.u.
0206C0:  DD 74 0D DD 77 08 EB 18 13 3A B6 60 B7 C2 FA 61    .t..w....:.`...a
0206D0:  DD 35 06 C2 FA 61 DD 6E 00 DD 66 01 7E B7 28 9A    .5...a.n..f.~.(.
0206E0:  FE FE 28 A5 FE FF 28 BB 16 00 E6 7F D6 0A DD 86    ..(...(.........
0206F0:  08 DD 77 07 87 5F E5 21 0C 63 19 7E DD 77 18 23    ..w.._.!.c.~.w.#
020700:  00 53 51 55 41 52 45 2D 31 46 4E 54 00 00 00 00    .SQUARE-1FNT....
020710:  00 00 02 00 00 00 7D 00 00 03 00 7D 00 00 00 00    ......}....}....
020720:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
020730:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
020740:  00 03 00 19 04 00 00 53 51 55 41 52 45 2D 31 24    .......SQUARE-1$
020750:  24 24 FF 00 FF 00 00 02 00 00 00 7D 00 00 03 00    $$.........}....
020760:  7D 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    }...............
020770:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
020780:  00 00 00 00 00 00 00 00 FE E6 E6 E6 FE E6 FE 00    ................
020790:  FE D6 D6 FE FE FE FE 00 FE D6 82 D6 82 D6 FE 00    ................
0207A0:  FE C2 AE C6 EA 86 FE 00 FE 9A 96 EE D2 B2 FE 00    ................
0207B0:  FE C6 92 CE 96 CA FE 00 FE F6 E6 FE FE FE FE 00    ................
0207C0:  FE E6 CE CE CE E6 FE 00 FE CE E6 E6 E6 CE FE 00    ................
0207D0:  FE D6 82 C6 82 D6 FE 00 FE EE EE 82 EE EE FE 00    ................
0207E0:  FE FE FE FE E6 CE FE 00 FE FE FE C6 FE FE FE 00    ................
0207F0:  FE FE FE FE E6 E6 FE 00 FE FA F6 EE DE BE FE 00    ................
020800:  FE C6 92 92 92 C6 FE 00 FE E6 C6 E6 E6 E6 FE 00    ................
020810:  FE 86 F2 C6 9E 82 FE 00 FE 86 F2 C6 F2 86 FE 00    ................
020820:  FE 9E 92 82 F2 F2 FE 00 FE 82 9E 86 F2 86 FE 00    ................
020830:  FE C6 9E 86 92 C6 FE 00 FE 82 F2 F2 F2 F2 FE 00    ................
020840:  FE C6 92 C6 92 C6 FE 00 FE C6 92 C2 F2 C6 FE 00    ................
020850:  FE E6 E6 FE E6 E6 FE 00 FE E6 E6 FE E6 CE FE 00    ................
020860:  FE E6 CE 9E CE E6 FE 00 FE FE C2 FE C2 FE FE 00    ................
020870:  FE CE E6 F2 E6 CE FE 00 FE C6 92 E2 FE E6 FE 00    ................
020880:  FE C6 92 82 92 92 FE 00 FE C6 92 82 92 92 FE 00    ................
020890:  FE 86 92 86 92 86 FE 00 FE C2 9E 9E 9E C2 FE 00    ................
0208A0:  FE 86 92 92 92 86 FE 00 FE 82 9E 86 9E 82 FE 00    ................
0208B0:  FE 82 9E 86 9E 9E FE 00 FE C2 9E 92 9A C2 FE 00    ................
0208C0:  FE 92 92 82 92 92 FE 00 FE E6 E6 E6 E6 E6 FE 00    ................
0208D0:  FE E2 F2 F2 92 86 FE 00 FE 92 92 86 92 92 FE 00    ................
0208E0:  FE 9E 9E 9E 9E 82 FE 00 FE BA 92 82 82 92 FE 00    ................
0208F0:  FE C6 82 92 92 92 FE 00 FE C6 92 92 92 C6 FE 00    ................
020900:  7E DD 77 19 E1 3E 01 CB 7E 20 0D 23 7E CB 7F 28    ~.w..>..~ .#~..(
020910:  07 E6 7F DD 77 06 18 53 DD 77 06 23 E5 7E F5 E6    ....w..S.w.#.~..
020920:  0F DD BE 05 28 06 DD 77 05 DD 72 0A 87 87 87 5F    ....(..w..r...._
020930:  21 42 64 19 50 59 ED A0 ED A0 ED A0 ED A0 ED A0    !Bd.PY..........
020940:  ED A0 ED A0 ED A0 F1 E1 E6 F0 28 1F FE F0 CA A0    ..........(.....
020950:  62 FE D0 CA BC 62 FE B0 CA C4 62 FE 80 D2 CC 62    b....b....b....b
020960:  FE 10 20 07 AF DD 77 1B DD 77 09 23 DD 75 00 DD    .. ...w..w.#.u..
020970:  74 01 DD 36 16 00 DD 36 17 20 DD 7E 17 B7 20 0E    t..6...6. .~.. .
020980:  DD 7E 15 B7 C8 DD 77 17 DD 7E 14 DD 77 16 16 00    .~....w..~..w...
020990:  DD 5E 16 DD 34 16 DD 35 17 DD 7E 1B B7 28 1A 67    .^..4..5..~..(.g
0209A0:  DD 6E 1A 19 7E DD 46 07 80 87 42 4F 21 0C 63 09    .n..~.F...BO!.c.
0209B0:  7E DD 77 18 23 7E DD 77 19 DD 66 0F DD 6E 0E 19    ~.w.#~.w..f..n..
0209C0:  19 4E 23 46 DD 6E 18 DD 66 19 09 4D DD 7E 02 CD    .N#F.n..f..M.~..
0209D0:  E4 62 4C DD 7E 03 CD E4 62 DD 66 11 DD 6E 10 19    .bL.~...b.f..n..
0209E0:  7E CB 7F 20 12 E6 0F DD 96 0A 30 01 AF DD B6 09    ~.. ......0.....
0209F0:  4F DD 7E 04 CD E4 62 DD 6E 12 DD 66 13 19 7E CB    O.~...b.n..f..~.
020A00:  7F C0 E6 1F DD 46 0B 4F B7 78 28 08 47 79 32 CF    .....F.O.x(.Gy2.
020A10:  60 78 D6 40 32 9B 62 3A C0 60 CB 47 32 C0 60 C9    `x.@2.b:.`.G2.`.
020A20:  23 7E E5 87 06 00 4F 21 C2 64 09 5E 23 56 DD 73    #~....O!.d.^#V.s
020A30:  1A DD 72 1B DD 36 09 00 E1 C3 EB 61 23 7E 32 BB    ..r..6.....a#~2.
020A40:  60 C3 EB 61 23 7E DD 77 0A C3 EB 61 DD 36 09 10    `..a#~.w...a.6..
020A50:  DD 36 1B 00 7E 0F 0F 0F 0F 32 ED 60 23 7E 32 DE    .6..~....2.`#~2.
020A60:  60 C3 EB 61 06 F4 ED 79 06 F6 ED 78 F6 C0 ED 79    `..a...y...x...y
020A70:  E6 3F ED 79 06 F4 ED 49 06 F6 4F F6 80 ED 79 ED    .?.y...I..O...y.
020A80:  49 C9 FF FF FF FF 82 66 AF 66 DC 66 EE 0E 18 0E    I......f.f.f....
020A90:  4D 0D 8E 0C DA 0B 2F 0B 8F 0A F7 09 68 09 E1 08    M...../.....h...
020AA0:  61 08 E9 07 77 07 0C 07 A7 06 47 06 ED 05 98 05    a...w.....G.....
020AB0:  47 05 FC 04 B4 04 70 04 31 04 F4 03 BC 03 86 03    G.....p.1.......
020AC0:  53 03 24 03 F6 02 CC 02 A4 02 7E 02 5A 02 38 02    S.$.......~.Z.8.
020AD0:  18 02 FA 01 DE 01 C3 01 AA 01 92 01 7B 01 66 01    ............{.f.
020AE0:  52 01 3F 01 2D 01 1C 01 0C 01 FD 00 EF 00 E1 00    R.?.-...........
020AF0:  D5 00 C9 00 BE 00 B3 00 A9 00 9F 00 96 00 8E 00    ................
020B00:  FE 86 92 92 86 9E FE 00 FE C2 92 92 C2 F2 FE 00    ................
020B10:  FE 86 92 92 86 92 FE 00 FE C2 9E C6 F2 86 FE 00    ................
020B20:  FE 82 CE CE CE CE FE 00 FE 92 92 92 92 C6 FE 00    ................
020B30:  FE 92 92 92 C6 EE FE 00 FE 92 92 82 92 BA FE 00    ................
020B40:  FE 92 92 C6 92 92 FE 00 FE 92 92 C2 E6 E6 FE 00    ................
020B50:  FE 82 E6 CE 9E 82 FE 00 FE C6 CE CE CE C6 FE 00    ................
020B60:  FE FE C6 9E 9E C6 FE 00 FE C6 E6 E6 E6 C6 FE 00    ................
020B70:  FE EE C6 FE FE FE FE 00 FE FE FE FE FE 82 FE 00    ................
020B80:  FE DE CE E6 FE FE FE 00 FE C6 92 82 92 92 FE 00    ................
020B90:  FE 86 92 86 92 86 FE 00 FE C2 9E 9E 9E C2 FE 00    ................
020BA0:  FE 86 92 92 92 86 FE 00 FE 82 9E 86 9E 82 FE 00    ................
020BB0:  FE 82 9E 86 9E 9E FE 00 FE C2 9E 92 9A C2 FE 00    ................
020BC0:  FE 92 92 82 92 92 FE 00 FE E6 E6 E6 E6 E6 FE 00    ................
020BD0:  FE E2 F2 F2 92 86 FE 00 FE 92 92 86 92 92 FE 00    ................
020BE0:  FE 9E 9E 9E 9E 82 FE 00 FE BA 92 82 82 92 FE 00    ................
020BF0:  FE C6 82 92 92 92 FE 00 FE C6 92 92 92 C6 FE 00    ................
020C00:  FE 86 92 92 86 9E FE 00 FE C2 92 92 C2 F2 FE 00    ................
020C10:  FE 86 92 92 86 92 FE 00 FE C2 9E C6 F2 86 FE 00    ................
020C20:  FE 82 CE CE CE CE FE 00 FE 92 92 92 92 C6 FE 00    ................
020C30:  FE 92 92 92 C6 EE FE 00 FE 92 92 82 92 BA FE 00    ................
020C40:  FE 92 92 C6 92 92 FE 00 FE 92 92 C2 E6 E6 FE 00    ................
020C50:  FE 82 E6 CE 9E 82 FE 00 FE 82 9E 86 9E 82 FE 00    ................
020C60:  FE 92 92 92 92 C6 FE 00 FE 82 9E 86 9E 82 FE 00    ................
020C70:  FE DA 92 FE FE FE FE 00 FE E2 CA CE CA 82 FE 00    ................
020C80:  FE C6 92 82 92 92 FE 00 FE C6 92 82 92 92 FE 00    ................
020C90:  FE 86 92 86 92 86 FE 00 FE C2 9E 9E 9E C2 FE 00    ................
020CA0:  FE 86 92 92 92 86 FE 00 FE 82 9E 86 9E 82 FE 00    ................
020CB0:  FE 82 9E 86 9E 9E FE 00 FE C2 9E 92 9A C2 FE 00    ................
020CC0:  FE 92 92 82 92 92 FE 00 FE E6 E6 E6 E6 E6 FE 00    ................
020CD0:  FE E2 F2 F2 92 86 FE 00 FE 92 92 86 92 92 FE 00    ................
020CE0:  FE 9E 9E 9E 9E 82 FE 00 FE BA 92 82 82 92 FE 00    ................
020CF0:  FE C6 82 92 92 92 FE 00 FE C6 92 92 92 C6 FE 00    ................
020D00:  86 00 7F 00 77 00 71 00 6A 00 64 00 5F 00 59 00    ....w.q.j.d._.Y.
020D10:  54 00 50 00 4B 00 47 00 43 00 3F 00 3C 00 38 00    T.P.K.G.C.?.<.8.
020D20:  35 00 32 00 2F 00 2D 00 2A 00 28 00 26 00 24 00    5.2./.-.*.(.&.$.
020D30:  22 00 20 00 1E 00 1C 00 1B 00 19 00 18 00 16 00    ". .............
020D40:  15 00 14 00 13 00 12 00 11 00 10 00 0F 00 00 00    ................
020D50:  00 00 00 00 00 00 00 00 00 00 00 00 00 01 08 00    ................
020D60:  00 00 00 00 00 DF 00 00 00 00 00 00 00 00 00 00    ................
020D70:  00 00 00 00 00 00 00 00 02 03 09 00 00 00 00 00    ................
020D80:  00 E7 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
020D90:  00 00 00 00 04 05 0A 00 00 00 00 00 00 EF 00 00    ................
020DA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
020DB0:  00 00 00 00 00 00 00 00 53 54 2D 4D 6F 64 75 6C    ........ST-Modul
020DC0:  65 2E E2 64 22 65 42 65 08 00 62 65 A2 65 C2 65    e..d"eBe..be.e.e
020DD0:  00 00 E2 65 22 66 42 65 10 10 E2 64 42 66 62 66    ...e"fBe...dBfbf
020DE0:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
020DF0:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
020E00:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
020E10:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
020E20:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
020E30:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
020E40:  00 00 DC 5E DC 5E DC 5E DC 5E DC 5E DC 5E DC 5E    ...^.^.^.^.^.^.^
020E50:  DC 5E DC 5E DC 5E DC 5E DC 5E DC 5E DC 5E DC 5E    .^.^.^.^.^.^.^.^
020E60:  DC 5E 00 00 00 00 00 00 00 00 00 00 00 00 00 00    .^..............
020E70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
020E80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
020E90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
020EA0:  00 00 0F 0E 0D 0C 0B 0A 0A 0A 0A 0A 0A 0A 0A 0A    ................
020EB0:  0A 0A 0A 0A 0A 0A 0A 0A 09 08 07 06 05 04 03 02    ................
020EC0:  01 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
020ED0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
020EE0:  00 00 80 00 00 01 80 01 00 02 80 02 00 03 00 04    ................
020EF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
020F00:  00 53 59 53 2D 55 4B 20 20 46 4E 54 00 00 00 00    .SYS-UK  FNT....
020F10:  00 00 02 00 00 00 90 00 00 03 00 00 00 00 00 00    ................
020F20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
020F30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
020F40:  00 03 00 8C 03 00 00 53 59 53 2D 55 4B 20 20 24    .......SYS-UK  $
020F50:  24 24 FF 00 FF 20 03 00 00 73 61 76 65 66 69 6C    $$... ...savefil
020F60:  E5 2C 0D 00 00 E2 2C 0D 00 00 66 6F 6E 74 E5 2C    .,....,...font.,
020F70:  0D 00 00 61 64 F2 F5 1C 00 90 00 00 00 1A E5 2C    ...ad..........,
020F80:  00 00 00 00 00 00 00 00 18 18 18 18 18 00 18 00    ................
020F90:  6C 6C 6C 00 00 00 00 00 6C 6C FE 6C FE 6C 6C 00    lll.....ll.l.ll.
020FA0:  18 3E 58 3C 1A 7C 18 00 00 C6 CC 18 30 66 C6 00    .>X<.|......0f..
020FB0:  38 6C 38 76 DC CC 76 00 18 18 30 00 00 00 00 00    8l8v..v...0.....
020FC0:  0C 18 30 30 30 18 0C 00 30 18 0C 0C 0C 18 30 00    ..000...0.....0.
020FD0:  00 66 3C FF 3C 66 00 00 00 18 18 7E 18 18 00 00    .f<.<f.....~....
020FE0:  00 00 00 00 00 18 18 30 00 00 00 7E 00 00 00 00    .......0...~....
020FF0:  00 00 00 00 00 18 18 00 06 0C 18 30 60 C0 80 00    ...........0`...
021000:  7C C6 CE D6 E6 C6 7C 00 18 38 18 18 18 18 7E 00    |.....|..8....~.
021010:  3C 66 06 3C 60 66 7E 00 3C 66 06 1C 06 66 3C 00    <f.<`f~.<f...f<.
021020:  1C 3C 6C CC FE 0C 1E 00 7E 62 60 7C 06 66 3C 00    .<l.....~b`|.f<.
021030:  3C 66 60 7C 66 66 3C 00 7E 66 06 0C 18 18 18 00    <f`|ff<.~f......
021040:  3C 66 66 3C 66 66 3C 00 3C 66 66 3E 06 66 3C 00    <ff<ff<.<ff>.f<.
021050:  00 00 18 18 00 18 18 00 00 00 18 18 00 18 18 30    ...............0
021060:  0C 18 30 60 30 18 0C 00 00 00 7E 00 00 7E 00 00    ..0`0.....~..~..
021070:  60 30 18 0C 18 30 60 00 3C 66 66 0C 18 00 18 00    `0...0`.<ff.....
021080:  7C C6 DE DE DE C0 7C 00 18 3C 66 66 7E 66 66 00    |.....|..<ff~ff.
021090:  FC 66 66 7C 66 66 FC 00 3C 66 C0 C0 C0 66 3C 00    .ff|ff..<f...f<.
0210A0:  F8 6C 66 66 66 6C F8 00 FE 62 68 78 68 62 FE 00    .lfffl...bhxhb..
0210B0:  FE 62 68 78 68 60 F0 00 3C 66 C0 C0 CE 66 3E 00    .bhxh`..<f...f>.
0210C0:  66 66 66 7E 66 66 66 00 7E 18 18 18 18 18 7E 00    fff~fff.~.....~.
0210D0:  1E 0C 0C 0C CC CC 78 00 E6 66 6C 78 6C 66 E6 00    ......x..flxlf..
0210E0:  F0 60 60 60 62 66 FE 00 C6 EE FE FE D6 C6 C6 00    .```bf..........
0210F0:  C6 E6 F6 DE CE C6 C6 00 38 6C C6 C6 C6 6C 38 00    ........8l...l8.
021100:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
021110:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
021120:  00 00 0F 0F 0E 0E 0D 0C 00 00 00 00 00 00 00 00    ................
021130:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
021140:  00 00 06 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
021150:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
021160:  00 00 01 00 01 00 01 00 01 00 00 00 00 00 00 00    ................
021170:  00 00 01 00 01 00 01 00 01 00 00 00 00 00 00 00    ................
021180:  00 00 01 00 01 00 01 00 01 00 00 00 00 00 00 00    ................
021190:  00 00 01 00 01 00 01 00 01 00 00 00 00 00 00 00    ................
0211A0:  00 00 0D 0E 0D 0D 80 80 80 80 80 80 80 80 80 80    ................
0211B0:  80 80 80 80 80 80 80 80 80 80 80 80 80 80 80 80    ................
0211C0:  80 80 0E 0C 0A 08 06 04 03 05 07 05 03 01 00 00    ................
0211D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0211E0:  00 00 07 0B 0F 13 17 1B 1F 13 08 03 00 00 00 00    ................
0211F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
021200:  00 00 00 09 67 00 09 67 00 5B 67 00 AD 67 00 FF    ....g..g.[g..g..
021210:  67 00 51 68 00 A3 68 00 F5 68 00 47 69 00 F5 6A    g.Qh.£h..h.Gi..j
021220:  00 99 69 00 EB 69 00 3D 6A 00 8F 6A 80 82 66 00    ..i..i.=j..j..f.
021230:  49 6B 00 93 6B 00 DF 6B 00 68 6C 00 EC 6C 00 54    Ik..k..k.hl..l.T
021240:  6D 00 95 6D 00 D1 6D 00 F8 6D 00 7B 6F 00 AC 6E    m..m..m..m.{o..n
021250:  00 F0 6E 00 29 6F 00 5B 6F 80 AF 66 00 CF 6F 00    ..n.)o.[o..f..o.
021260:  AA 70 00 85 71 00 60 72 00 39 73 00 12 74 00 EB    .p..q.`r.9s..t..
021270:  74 00 C4 75 00 9D 76 00 B3 7B 00 4F 78 00 28 79    t..u..v..{.Ox.(y
021280:  00 01 7A 00 DA 7A 80 DC 66 27 02 00 2E 82 33 82    ..z..z..f'....3.
021290:  2E 82 27 82 2E 82 33 82 2E 82 27 82 2E 82 33 82    ..'...3...'...3.
0212A0:  2E 82 27 82 2E 82 33 82 2E 82 27 82 2E 82 33 82    ..'...3...'...3.
0212B0:  2E 82 27 82 2E 82 33 82 2E 82 28 82 2F 82 34 82    ..'...3...(./.4.
0212C0:  2F 82 28 82 2F 82 34 82 2F 82 28 82 2F 82 34 82    /.(./.4./.(./.4.
0212D0:  2F 82 28 82 2F 82 34 82 2F 82 FF 27 02 00 2E 82    /.(./.4./..'....
0212E0:  33 82 2E 82 27 82 2E 82 33 82 2E 82 27 82 2E 82    3...'...3...'...
0212F0:  33 82 2E 82 27 82 2E 82 33 82 2E 82 2C 82 2F 82    3...'...3...,./.
021300:  FC 66 66 7C 60 60 F0 00 38 6C C6 C6 DA CC 76 00    .ff|``..8l....v.
021310:  FC 66 66 7C 6C 66 E6 00 3C 66 60 3C 06 66 3C 00    .ff|lf..<f`<.f<.
021320:  7E 5A 18 18 18 18 3C 00 66 66 66 66 66 66 3C 00    ~Z....<.ffffff<.
021330:  66 66 66 66 66 3C 18 00 C6 C6 C6 D6 FE EE C6 00    fffff<..........
021340:  C6 6C 38 38 6C C6 C6 00 66 66 66 3C 18 18 3C 00    .l88l...fff<..<.
021350:  FE C6 8C 18 32 66 FE 00 3C 30 30 30 30 30 3C 00    ....2f..<00000<.
021360:  C0 60 30 18 0C 06 02 00 3C 0C 0C 0C 0C 0C 3C 00    .`0.....<.....<.
021370:  18 3C 7E 18 18 18 18 00 00 00 00 00 00 00 00 FF    .<~.............
021380:  30 18 0C 00 00 00 00 00 00 00 78 0C 7C CC 76 00    0.........x.|.v.
021390:  E0 60 7C 66 66 66 DC 00 00 00 3C 66 60 66 3C 00    .`|fff....<f`f<.
0213A0:  1C 0C 7C CC CC CC 76 00 00 00 3C 66 7E 60 3C 00    ..|...v...<f~`<.
0213B0:  1C 36 30 78 30 30 78 00 00 00 3E 66 66 3E 06 7C    .60x00x...>ff>.|
0213C0:  E0 60 6C 76 66 66 E6 00 18 00 38 18 18 18 3C 00    .`lvff....8...<.
0213D0:  06 00 0E 06 06 66 66 3C E0 60 66 6C 78 6C E6 00    .....ff<.`flxl..
0213E0:  38 18 18 18 18 18 3C 00 00 00 6C FE D6 D6 C6 00    8.....<...l.....
0213F0:  00 00 DC 66 66 66 66 00 00 00 3C 66 66 66 3C 00    ...ffff...<fff<.
021400:  00 00 DC 66 66 7C 60 F0 00 00 76 CC CC 7C 0C 1E    ...ff|`...v..|..
021410:  00 00 DC 76 60 60 F0 00 00 00 3C 60 3C 06 7C 00    ...v``....<`<.|.
021420:  30 30 7C 30 30 36 1C 00 00 00 66 66 66 66 3E 00    00|006....ffff>.
021430:  00 00 66 66 66 3C 18 00 00 00 C6 D6 D6 FE 6C 00    ..fff<........l.
021440:  00 00 C6 6C 38 6C C6 00 00 00 66 66 66 3E 06 7C    ...l8l....fff>.|
021450:  00 00 7E 4C 18 32 7E 00 0E 18 18 70 18 18 0E 00    ..~L.2~....p....
021460:  18 18 18 18 18 18 18 00 70 18 18 0E 18 18 70 00    ........p.....p.
021470:  76 DC 00 00 00 00 00 00 CC 33 CC 33 CC 33 CC 33    v........3.3.3.3
021480:  7C C6 DE DE DE C0 7C 00 18 3C 66 66 7E 66 66 00    |.....|..<ff~ff.
021490:  FC 66 66 7C 66 66 FC 00 3C 66 C0 C0 C0 66 3C 00    .ff|ff..<f...f<.
0214A0:  F8 6C 66 66 66 6C F8 00 FE 62 68 78 68 62 FE 00    .lfffl...bhxhb..
0214B0:  FE 62 68 78 68 60 F0 00 3C 66 C0 C0 CE 66 3E 00    .bhxh`..<f...f>.
0214C0:  66 66 66 7E 66 66 66 00 7E 18 18 18 18 18 7E 00    fff~fff.~.....~.
0214D0:  1E 0C 0C 0C CC CC 78 00 E6 66 6C 78 6C 66 E6 00    ......x..flxlf..
0214E0:  F0 60 60 60 62 66 FE 00 C6 EE FE FE D6 C6 C6 00    .```bf..........
0214F0:  C6 E6 F6 DE CE C6 C6 00 38 6C C6 C6 C6 6C 38 00    ........8l...l8.
021500:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
021510:  1C 00 01 00 02 09 4E E5 1C 00 C1 02 00 00 00 02    ......N.........
021520:  1C 00 C6 02 00 00 00 02 1C 00 C2 02 00 00 00 02    ................
021530:  1C 00 C7 02 00 00 00 02 1C 00 C3 02 00 00 00 02    ................
021540:  1C 00 C8 02 00 00 00 02 1C 00 C4 02 00 00 00 02    ................
021550:  1C 00 C9 02 00 00 00 02 1C 00 C5 02 00 00 00 02    ................
021560:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
021570:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
021580:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
021590:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0215A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0215B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0215C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0215D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0215E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0215F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
021600:  34 82 2F 82 2C 82 2F 82 34 82 2F 82 2C 82 2F 82    4./.,./.4./.,./.
021610:  34 82 2F 82 2C 82 2F 82 34 82 2F 82 2A 82 31 82    4./.,./.4./.*.1.
021620:  33 82 31 82 2A 82 31 82 33 82 31 82 FF 2A 02 00    3.1.*.1.3.1..*..
021630:  31 82 33 82 31 82 2A 82 31 82 33 82 31 82 28 82    1.3.1.*.1.3.1.(.
021640:  2F 82 31 82 2F 82 28 82 2F 82 31 82 2F 82 28 82    /.1./.(./.1./.(.
021650:  2F 82 31 82 2F 82 28 82 2F 82 31 82 2F 82 33 82    /.1./.(./.1./.3.
021660:  3A 82 3B 82 3A 82 3F 82 46 82 47 82 46 82 4B 82    :.;.:.?.F.G.F.K.
021670:  46 82 47 82 46 82 4B 82 46 82 47 82 46 82 FF 4B    F.G.F.K.F.G.F..K
021680:  02 00 46 82 47 82 46 82 4B 82 46 82 47 82 46 82    ..F.G.F.K.F.G.F.
021690:  4B 82 46 82 47 82 46 82 4B 82 46 82 47 82 46 82    K.F.G.F.K.F.G.F.
0216A0:  27 82 2E 82 33 82 27 82 2E 82 33 82 27 82 2E 82    '...3.'...3.'...
0216B0:  33 82 27 82 2E 82 33 82 27 82 2E 82 28 82 2F 82    3.'...3.'...(./.
0216C0:  34 82 28 82 2F 82 34 82 28 82 2F 82 34 82 28 82    4.(./.4.(./.4.(.
0216D0:  FF 28 02 00 2F 82 34 82 27 82 2E 82 33 82 27 82    .(../.4.'...3.'.
0216E0:  2E 82 33 82 27 82 2E 82 33 82 27 82 2E 82 33 82    ..3.'...3.'...3.
0216F0:  27 82 2E 82 28 82 2F 82 34 82 28 82 2F 82 34 82    '...(./.4.(./.4.
021700:  28 82 2F 82 34 82 28 82 2F 82 34 82 28 82 2F 82    (./.4.(./.4.(./.
021710:  2A 82 31 82 36 82 2A 82 31 82 36 82 2A 82 31 82    *.1.6.*.1.6.*.1.
021720:  36 82 FF 2A 02 00 31 82 36 82 2A 82 31 82 36 82    6..*..1.6.*.1.6.
021730:  2C 82 33 82 38 82 33 82 2C 82 33 82 38 82 33 82    ,.3.8.3.,.3.8.3.
021740:  2C 82 33 82 38 82 33 82 2C 82 33 82 38 82 33 82    ,.3.8.3.,.3.8.3.
021750:  2C 82 33 82 38 82 33 82 2C 82 33 82 38 82 33 82    ,.3.8.3.,.3.8.3.
021760:  2A 82 31 82 36 82 31 82 2A 82 31 82 36 82 31 82    *.1.6.1.*.1.6.1.
021770:  25 82 2C 82 FF 31 02 00 2C 82 25 82 2C 82 31 82    %.,..1..,.%.,.1.
021780:  2C 82 28 82 2F 82 34 82 2F 82 28 82 2F 82 34 82    ,.(./.4./.(./.4.
021790:  2F 82 2C 82 33 82 38 82 33 82 2C 82 33 82 38 82    /.,.3.8.3.,.3.8.
0217A0:  33 82 2C 82 33 82 38 82 33 82 2C 82 33 82 38 82    3.,.3.8.3.,.3.8.
0217B0:  33 82 25 82 2C 82 31 82 2C 82 25 82 2C 82 31 82    3.%.,.1.,.%.,.1.
0217C0:  2C 82 28 82 2F 82 FF 34 02 00 2F 82 28 82 2F 82    ,.(./..4../.(./.
0217D0:  34 82 2F 82 2A 82 31 82 36 82 31 82 2A 82 31 82    4./.*.1.6.1.*.1.
0217E0:  36 82 31 82 2C 82 33 82 38 82 33 82 2C 82 33 82    6.1.,.3.8.3.,.3.
0217F0:  38 82 33 82 25 82 2C 82 31 82 2C 82 25 82 2C 82    8.3.%.,.1.,.%.,.
021800:  03 D5 B3 04 FF A7 01 E3 B3 04 E3 B3 04 E3 B3 04    ................
021810:  E3 B3 04 E3 B3 04 A7 01 E3 B3 04 A7 01 E3 B3 04    ................
021820:  E3 B3 04 E3 B3 04 BF 03 E3 B3 04 E3 B3 04 E3 B3    ................
021830:  04 A7 01 E3 B3 04 E3 B3 04 E3 B3 04 E3 B3 04 E3    ................
021840:  B3 04 A7 01 E3 B3 04 A7 01 E3 B3 04 E3 B3 04 E3    ................
021850:  B3 04 BF 03 E3 B3 04 E3 B3 04 E3 B3 04 A7 01 DC    ................
021860:  B3 04 DC B3 04 DC B3 04 DC B3 04 DC B3 04 A7 01    ................
021870:  DC B3 04 A7 01 DC B3 04 DC B3 04 DC B3 04 BF 03    ................
021880:  DC B3 04 DC B3 04 DC B3 04 A8 01 DC B3 04 DC B3    ................
021890:  04 DC B3 04 DC B3 04 DC B3 04 A8 01 DC B3 04 A8    ................
0218A0:  01 DC B3 04 DC B3 04 DC B3 04 C0 03 DC B3 04 C0    ................
0218B0:  03 DC B3 04 A8 01 DA B3 04 DA B3 04 DA B3 04 DA    ................
0218C0:  B3 04 DA B3 04 A8 01 DA B3 04 A8 01 DA B3 04 DA    ................
0218D0:  B3 04 DA B3 04 C0 03 DA B3 04 C0 03 DA B3 04 FF    ................
0218E0:  A7 01 DA B3 04 DA B3 04 DA B3 04 DA B3 04 DA B3    ................
0218F0:  04 A7 01 DA B3 04 A7 01 DA B3 04 DA B3 04 DA B3    ................
021900:  04 BF 03 DA B3 04 DA B3 04 DA B3 04 A7 01 D8 B3    ................
021910:  04 D8 B3 04 D8 B3 04 D8 B3 04 D8 B3 04 A7 01 D8    ................
021920:  B3 04 A7 01 D8 B3 04 D8 B3 04 D8 B3 04 BF 03 D8    ................
021930:  B3 04 D8 B3 04 D8 B3 04 A7 01 D8 B3 04 D8 B3 04    ................
021940:  D8 B3 04 D8 B3 04 D8 B3 04 A7 01 D8 B3 04 A7 01    ................
021950:  D8 B3 04 D8 B3 04 D8 B3 04 BF 03 D8 B3 04 A6 01    ................
021960:  D8 03 A8 01 D7 B3 04 D7 B3 04 D7 B3 04 D7 B3 04    ................
021970:  D7 B3 04 A8 01 D7 B3 04 A8 01 D7 B3 04 D7 B3 04    ................
021980:  D7 B3 04 C0 03 D7 B3 04 C0 03 D7 B3 04 A8 01 D7    ................
021990:  B3 04 D7 B3 04 D7 B3 04 D7 B3 04 D7 B3 04 A8 01    ................
0219A0:  D7 B3 04 A8 01 D7 B3 04 D7 B3 04 D7 B3 04 C0 03    ................
0219B0:  D7 B3 04 C0 03 D7 B3 04 FF A7 01 DA B3 04 DA B3    ................
0219C0:  04 DA B3 04 DA B3 04 DA B3 04 A7 01 DA B3 04 A7    ................
0219D0:  01 DA B3 04 DA B3 04 DA B3 04 BF 03 DA B3 04 DA    ................
0219E0:  B3 04 DA B3 04 A7 01 D7 B3 04 D7 B3 04 D7 B3 04    ................
0219F0:  D7 B3 04 D7 B3 04 A7 01 D7 B3 04 A7 01 D7 B3 04    ................
021A00:  31 82 2C 82 2A 82 31 82 36 82 31 82 2A 82 31 82    1.,.*.1.6.1.*.1.
021A10:  36 82 31 82 2A 82 31 82 FF 2F 02 00 34 82 2A 82    6.1.*.1../..4.*.
021A20:  31 82 36 82 31 82 2A 82 31 82 36 82 31 82 28 82    1.6.1.*.1.6.1.(.
021A30:  2F 82 34 82 2F 82 28 82 2F 82 34 82 2F 82 2A 82    /.4./.(./.4./.*.
021A40:  31 82 36 82 31 82 2A 82 31 82 36 82 31 82 2C 82    1.6.1.*.1.6.1.,.
021A50:  33 82 38 82 33 82 2C 82 33 82 38 82 33 82 2C 82    3.8.3.,.3.8.3.,.
021A60:  33 82 38 82 33 82 2B 82 33 82 FF 37 02 00 33 82    3.8.3.+.3..7..3.
021A70:  2B 82 33 82 37 82 33 82 2A 82 31 82 36 82 31 82    +.3.7.3.*.1.6.1.
021A80:  2A 82 31 82 36 82 31 82 28 82 2F 82 34 82 2F 82    *.1.6.1.(./.4./.
021A90:  28 82 2F 82 34 82 2F 82 27 82 2E 82 33 82 2E 82    (./.4./.'...3...
021AA0:  27 82 2E 82 33 82 2E 82 28 82 2F 82 34 82 2F 82    '...3...(./.4./.
021AB0:  28 82 2F 82 34 82 2F 82 2A 82 31 82 FF 36 02 00    (./.4./.*.1..6..
021AC0:  31 82 2A 82 31 82 36 82 31 82 2C 82 33 82 38 82    1.*.1.6.1.,.3.8.
021AD0:  33 82 2C 82 33 82 38 82 33 82 27 82 2E 82 33 82    3.,.3.8.3.'...3.
021AE0:  2E 82 27 82 2E 82 33 82 2E 82 28 82 2F 82 34 82    ..'...3...(./.4.
021AF0:  2F 82 28 82 2F 82 34 82 2F 82 2A 82 31 82 36 82    /.(./.4./.*.1.6.
021B00:  31 82 2A 82 31 82 36 82 31 82 2C 82 33 82 FF 38    1.*.1.6.1.,.3..8
021B10:  02 B0 00 33 02 00 2C 82 2F 82 38 82 33 02 B0 00    ...3..,./.8.3...
021B20:  2C 02 B0 01 2F 82 34 82 2F 82 2A 02 B0 02 2F 82    ,.../.4./.*.../.
021B30:  33 82 2F 82 2A 02 B0 03 2F 82 36 82 2F 82 28 02    3./.*.../.6./.(.
021B40:  B0 04 2F 82 34 82 2F 82 28 02 B0 05 2F 82 33 82    ../.4./.(.../.3.
021B50:  2F 82 27 02 B0 06 2E 82 33 02 B0 07 2E 82 27 02    /.'.....3.....'.
021B60:  B0 08 2E 82 33 02 B0 09 2E 02 B0 0A 27 02 B0 0B    ....3.......'...
021B70:  2E 0A B0 0D FF 36 02 B0 00 31 02 00 2C 82 33 82    .....6...1..,.3.
021B80:  38 82 33 82 2C 82 33 82 38 82 33 82 25 82 2C 82    8.3.,.3.8.3.%.,.
021B90:  31 82 2C 82 25 82 2C 82 31 82 2C 82 2A 82 31 82    1.,.%.,.1.,.*.1.
021BA0:  36 82 31 82 2A 82 31 82 36 82 31 82 2A 82 31 82    6.1.*.1.6.1.*.1.
021BB0:  36 82 31 82 2A 82 31 82 36 82 31 82 28 82 2F 82    6.1.*.1.6.1.(./.
021BC0:  34 82 2F 82 28 82 2F 82 FF 46 10 02 C6 B2 01 C6    4./.(./..F......
021BD0:  B2 01 C6 B2 02 C6 B2 02 C6 B2 03 C6 B2 03 46 82    ..............F.
021BE0:  43 04 B2 00 44 02 02 46 82 43 84 3F 84 3A 84 3F    C...D..F.C.?.:.?
021BF0:  84 40 82 42 82 44 88 44 82 46 82 47 86 C7 B2 00    .@.B.D.D.F.G....
021C00:  D7 B3 04 D7 B3 04 BF 03 D7 B3 04 D7 B3 04 D7 B3    ................
021C10:  04 A7 01 D7 B3 04 D7 B3 04 D7 B3 04 D7 B3 04 D7    ................
021C20:  B3 04 A7 01 D7 B3 04 A7 01 D7 B3 04 D7 B3 04 D7    ................
021C30:  B3 04 BF 03 D7 B3 04 A6 01 D7 03 A8 01 DA B3 04    ................
021C40:  DA B3 04 DA B3 04 DA B3 04 DA B3 04 A8 01 DA B3    ................
021C50:  04 A8 01 DA B3 04 DA B3 04 DA B3 04 C0 03 DC B3    ................
021C60:  04 C0 03 DC B3 04 A8 01 DC B3 04 DC B3 04 DC B3    ................
021C70:  04 DC B3 04 DC B3 04 A8 01 DC B3 04 A8 01 DC B3    ................
021C80:  04 DC B3 04 DC B3 04 C0 03 DC B3 04 C0 03 DC B3    ................
021C90:  04 FF DA 03 DA B3 04 DA B3 04 DA B3 04 DA B3 04    ................
021CA0:  DA B3 04 A7 01 DA B3 04 A7 01 DA B3 04 D7 B3 04    ................
021CB0:  D7 B3 04 BF 03 D7 B3 04 D7 B3 04 D7 B3 04 A7 01    ................
021CC0:  D7 B3 04 D7 B3 04 D7 B3 04 D7 B3 04 D7 B3 04 A7    ................
021CD0:  01 D7 B3 04 A7 01 D7 B3 04 D7 B3 04 D7 B3 04 BF    ................
021CE0:  03 D7 B3 04 D7 B3 04 D7 B3 04 A7 01 D7 B3 04 D5    ................
021CF0:  B3 04 D5 B3 04 D5 B3 04 D5 B3 04 A7 01 D5 B3 04    ................
021D00:  A7 01 D5 B3 04 D5 B3 04 D5 B3 04 BF 03 D5 B3 04    ................
021D10:  A6 01 D5 03 A8 01 D5 B3 04 D5 B3 04 D5 B3 04 D5    ................
021D20:  B3 04 D5 B3 04 A8 01 D5 B3 04 A8 01 D5 B3 04 D5    ................
021D30:  B3 04 D5 B3 04 C0 03 D5 B3 04 D7 03 D7 B3 04 A8    ................
021D40:  01 D7 B3 04 D7 B3 04 D7 B3 04 D7 B3 04 D7 B3 04    ................
021D50:  A8 01 D7 B3 04 A8 01 D7 B3 04 D7 B3 04 D7 B3 04    ................
021D60:  C0 03 D7 B3 04 C0 03 D7 B3 04 FF D7 03 D7 B3 04    ................
021D70:  D7 B3 04 D7 B3 04 D7 B3 04 D7 B3 04 A7 01 D7 B3    ................
021D80:  04 A7 01 D7 B3 04 D7 B3 04 D7 B3 04 BF 03 D7 B3    ................
021D90:  04 D7 B3 04 D7 B3 04 A7 01 D7 B3 04 D7 B3 04 D7    ................
021DA0:  B3 04 D7 B3 04 D7 B3 04 A7 01 D7 B3 04 A7 01 D7    ................
021DB0:  B3 04 D7 B3 04 D7 B3 04 BF 03 D7 B3 04 D7 B3 04    ................
021DC0:  D7 B3 04 A7 01 D7 B3 04 D7 B3 04 D7 B3 04 D7 B3    ................
021DD0:  04 D7 B3 04 A7 01 D7 B3 04 A7 01 D7 B3 04 D7 B3    ................
021DE0:  04 D7 B3 04 BF 03 DC B3 04 A6 01 DC 03 A8 01 DC    ................
021DF0:  B3 04 DC B3 04 DC B3 04 DC B3 04 DC B3 04 A8 01    ................
021E00:  C7 B2 00 C7 B2 01 C7 B2 03 47 82 46 02 B2 00 44    .........G.F...D
021E10:  02 02 FF 46 0F 02 C6 02 C6 02 C6 02 C6 02 C6 02    ...F............
021E20:  C6 B2 02 C6 B2 02 46 02 B2 03 43 04 B2 00 44 02    ......F...C...D.
021E30:  02 46 82 43 84 3F 84 3A 84 3F 84 3D 90 BD B2 01    .F.C.?.:.?.=....
021E40:  BD B2 01 BD B2 02 BD B2 03 BD B2 04 BD B2 04 3D    ...............=
021E50:  02 B2 05 3D 02 B2 00 3B 02 02 3A 82 38 82 FF BA    ...=...;..:.8...
021E60:  B2 00 BA B2 00 BA B2 00 BA B2 01 BA B2 01 BA B2    ................
021E70:  01 BA B2 02 BA B2 02 BA B2 02 BA B2 03 BA B2 03    ................
021E80:  BA B2 03 BA B2 04 BA B2 04 BA B2 04 BA B2 05 BA    ................
021E90:  B2 05 BA B2 05 BA B2 05 BA B2 06 BA B2 08 BA B2    ................
021EA0:  09 BA B2 0A BA B2 0B BA B2 0C BA B2 0D BA B2 0E    ................
021EB0:  3A 05 B2 0F 40 02 B2 00 3F 02 02 3B 82 3F 82 40    :...@...?..;.?.@
021EC0:  82 3F 82 3B 82 3F 82 40 82 3F 82 3B 82 3F 82 40    .?.;.?.@.?.;.?.@
021ED0:  82 3F 82 3B 82 3F 82 3F 82 3D 82 3A 82 3D 82 3F    .?.;.?.?.=.:.=.?
021EE0:  82 3D 82 3A 82 3D 82 FF 3F 02 B2 00 3D 02 02 3A    .=.:.=..?...=..:
021EF0:  82 3D 82 3F 82 3D 82 3A 82 3D 82 3D 82 3B 82 34    .=.?.=.:.=.=.;.4
021F00:  82 3B 82 3D 82 3B 82 34 82 3B 82 3D 82 3B 82 34    .;.=.;.4.;.=.;.4
021F10:  82 3B 82 3D 82 3B 82 3A 82 38 82 BA B2 00 BA B2    .;.=.;.:.8......
021F20:  00 BA B2 00 BA B2 01 BA B2 01 BA B2 02 BA B2 02    ................
021F30:  BA B2 03 BA B2 03 BA B2 04 BA B2 05 BA B2 06 BA    ................
021F40:  B2 07 BA B2 0A 3A 02 B2 0E B1 B0 00 B1 B0 00 B1    .....:..........
021F50:  B0 01 B1 B0 03 B1 B0 03 B1 B0 03 B1 B0 04 B1 B0    ................
021F60:  04 B1 B0 05 B1 B0 05 31 06 B0 06 FF BB B0 00 BB    .......1........
021F70:  B0 00 BB B0 01 BB B0 03 BB B0 03 BB B0 03 BB B0    ................
021F80:  04 BB B0 05 3B 08 B0 06 BA B0 00 BA B0 01 BA B0    ....;...........
021F90:  02 BA B0 03 BA B0 03 BA B0 04 BA B0 04 BA B0 05    ................
021FA0:  3A 08 B0 06 4B 02 02 46 82 3F 82 49 82 44 82 3D    :...K..F.?.I.D.=
021FB0:  82 47 82 42 82 3B 82 46 82 3F 82 3A 82 46 82 3F    .G.B.;.F.?.:.F.?
021FC0:  82 44 82 3F 82 38 82 42 82 3D 82 38 82 40 82 3B    .D.?.8.B.=.8.@.;
021FD0:  82 38 84 FF 3F 02 00 3D 82 3F 82 3A 82 33 82 3D    .8..?..=.?.:.3.=
021FE0:  82 38 82 33 82 3B 82 36 82 33 82 3A 82 36 82 33    .8.3.;.6.3.:.6.3
021FF0:  82 3A 82 36 82 38 82 33 82 2C 82 36 82 31 82 2C    .:.6.8.3.,.6.1.,
022000:  DC B3 04 A8 01 DC B3 04 DC B3 04 DC B3 04 C0 03    ................
022010:  DA B3 04 C0 03 DA B3 04 A8 01 DA B3 04 DA B3 04    ................
022020:  DA B3 04 DA B3 04 DA B3 04 A8 01 DA B3 04 A8 01    ................
022030:  DA B3 04 DA B3 04 DA B3 04 C0 03 D5 B3 04 C0 03    ................
022040:  D5 B3 04 FF D5 03 D5 B3 04 D5 B3 04 D5 B3 04 D5    ................
022050:  B3 04 D5 B3 04 A7 01 D5 B3 04 A7 01 D5 B3 04 D5    ................
022060:  B3 04 D5 B3 04 BF 03 D8 B3 04 D8 B3 04 D8 B3 04    ................
022070:  A7 01 D8 B3 04 D8 B3 04 D8 B3 04 D8 B3 04 D8 B3    ................
022080:  04 A7 01 D8 B3 04 A7 01 D8 B3 04 D8 B3 04 D8 B3    ................
022090:  04 BF 03 DC B3 04 DC B3 04 DC B3 04 A7 01 DC B3    ................
0220A0:  04 DC B3 04 DC B3 04 DC B3 04 DC B3 04 A7 01 DC    ................
0220B0:  B3 04 A7 01 DC B3 04 DC B3 04 DC B3 04 BF 03 DA    ................
0220C0:  B3 04 A6 01 DA 03 A8 01 DA B3 04 DA B3 04 DA B3    ................
0220D0:  04 DA B3 04 DA B3 04 A8 01 DA B3 04 A8 01 DA B3    ................
0220E0:  04 DA B3 04 DA B3 04 C0 03 D5 B3 04 C0 03 D5 B3    ................
0220F0:  04 A8 01 D5 B3 04 D5 B3 04 D5 B3 04 D5 B3 04 D5    ................
022100:  B3 04 A8 01 D5 B3 04 A8 01 D5 B3 04 D5 B3 04 D5    ................
022110:  B3 04 C0 03 D8 B3 04 C0 03 D8 B3 04 FF D8 03 D8    ................
022120:  B3 04 D8 B3 04 D8 B3 04 D8 B3 04 D8 B3 04 A7 01    ................
022130:  D8 B3 04 A7 01 D8 B3 04 DA B3 04 DA B3 04 BF 03    ................
022140:  DA B3 04 DA B3 04 DA B3 04 A7 01 DA B3 04 DA B3    ................
022150:  04 DA B3 04 DA B3 04 DA B3 04 A7 01 DA B3 04 A7    ................
022160:  01 DA B3 04 DA B3 04 DA B3 04 BF 03 DC B3 04 DC    ................
022170:  B3 04 DC B3 04 A7 01 DC B3 04 DC B3 04 DC B3 04    ................
022180:  DC B3 04 DC B3 04 A7 01 DC B3 04 A7 01 DC B3 04    ................
022190:  DC B3 04 DC B3 04 BF 03 DC B3 04 A6 01 DC 03 A8    ................
0221A0:  01 DC B3 04 DC B3 04 DC B3 04 DC B3 04 DC B3 04    ................
0221B0:  A8 01 DC B3 04 A8 01 DC B3 04 DC B3 04 DC B3 04    ................
0221C0:  C0 03 DA B3 04 C0 03 DA B3 04 A8 01 DA B3 04 DA    ................
0221D0:  B3 04 DA B3 04 DA B3 04 DA B3 04 A8 01 DA B3 04    ................
0221E0:  A8 01 DA B3 04 DA B3 04 DA B3 04 C0 03 DA B3 04    ................
0221F0:  C0 03 DA B3 04 FF DA 03 DA B3 04 DC B3 04 DA B3    ................
022200:  82 34 82 2F 82 2C 88 3F 82 3D 82 3F 06 02 3D 86    .4./.,.?.=.?..=.
022210:  3B 84 3F 84 FF 00 02 3D 06 B2 00 3B 04 02 3F 88    ;.?....=...;..?.
022220:  BF B2 01 BF B2 01 BF B2 02 BF B2 02 BF B2 03 BF    ................
022230:  B2 04 BF B2 05 BF B2 06 3F 10 B2 0E 53 06 B2 00    ........?...S...
022240:  52 88 D0 02 CE 02 53 86 52 88 D0 02 CE 02 4C 84    R.....S.R.....L.
022250:  FF 00 0A CB 02 C7 02 4E 84 4C 82 4B 86 49 84 53    .......N.L.K.I.S
022260:  86 52 88 D0 02 CE 02 53 86 52 88 D0 02 CE 02 4C    .R.....S.R.....L
022270:  8E CB 02 C7 02 4E 84 FF 4C 02 02 4B 86 49 82 46    .....N..L..K.I.F
022280:  85 C6 B2 01 C6 B2 01 C6 B2 01 C6 B2 02 46 07 B2    .............F..
022290:  03 46 02 B2 00 47 06 02 49 84 4B 03 B2 00 CB B2    .F...G..I.K.....
0222A0:  0F 4B 08 B2 00 CB B2 01 CB B2 01 CB B2 02 CB B2    .K..............
0222B0:  02 CB B2 03 CB B2 04 49 02 B2 00 46 0A 02 C6 B2    .......I...F....
0222C0:  01 C6 B2 01 C6 B2 02 C6 B2 02 C6 B2 03 46 07 B2    .............F..
0222D0:  04 FF 00 02 46 02 02 47 86 49 84 4B 03 B2 00 CB    ....F..G.I.K....
0222E0:  B2 05 4B 06 B2 00 CB B2 01 CB B2 01 CB B2 02 CB    ..K.............
0222F0:  B2 02 CB B2 03 CB B2 04 4B 02 B2 06 49 02 B2 00    ........K...I...
022300:  4E 0A 02 CE B2 01 CE B2 01 CE B2 02 CE B2 02 CE    N...............
022310:  B2 03 CE B2 03 CE B2 04 4E 8F 4E 02 B2 00 4C 02    ........N.N...L.
022320:  02 4B 82 47 82 44 82 4C 82 4B 82 FF 47 02 02 44    .K.G.D.L.K..G..D
022330:  82 42 82 46 82 49 82 4E 82 42 82 46 82 49 82 4E    .B.F.I.N.B.F.I.N
022340:  82 4C 82 4B 82 47 82 44 82 4C 82 4B 82 47 82 44    .L.K.G.D.L.K.G.D
022350:  82 42 82 46 82 49 82 4E 82 42 82 46 82 49 82 4E    .B.F.I.N.B.F.I.N
022360:  82 44 82 4B 82 4E 82 53 8E 52 82 50 82 52 84 FF    .D.K.N.S.R.P.R..
022370:  D2 B2 00 D2 B2 00 D2 B2 00 D2 B2 01 D2 B2 02 D2    ................
022380:  B2 03 D2 B2 04 D2 B2 05 52 02 B2 06 52 0E B2 00    ........R...R...
022390:  50 02 02 4E 82 50 10 B2 01 4F 06 02 50 86 52 84    P..N.P...O..P.R.
0223A0:  50 86 52 86 53 84 52 84 FF 50 04 02 4E 82 50 84    P.R.S.R..P..N.P.
0223B0:  4B 90 4B 82 4F 86 50 84 52 86 50 86 52 86 53 84    K.K.O.P.R.P.R.S.
0223C0:  52 84 50 84 4E 82 D2 B2 00 D2 B2 00 D2 B2 01 D2    R.P.N...........
0223D0:  B2 03 52 02 B2 05 50 04 B2 00 FF D0 B2 01 D0 B2    ..R...P.........
0223E0:  01 D0 B2 02 D0 B2 02 D0 B2 03 D0 B2 04 D0 B2 05    ................
0223F0:  D0 B2 07 D0 B2 0B 50 47 B2 0F FF 00 02 46 02 02    ......PG.....F..
022400:  04 DC B3 04 DC B3 04 A7 01 DC B3 04 A7 01 DC B3    ................
022410:  04 DC B3 04 DC B3 04 BF 03 DC B3 04 DC B3 04 DC    ................
022420:  B3 04 A7 01 DC B3 04 DC B3 04 DC B3 04 D5 B3 04    ................
022430:  D5 B3 04 A7 01 D5 B3 04 A7 01 D5 B3 04 D5 B3 04    ................
022440:  D5 B3 04 BF 03 D5 B3 04 D5 B3 04 D5 B3 04 A7 01    ................
022450:  D5 B3 04 D5 B3 04 D5 B3 04 DA B3 04 DA B3 04 A7    ................
022460:  01 DA B3 04 A7 01 DA B3 04 DA B3 04 DA B3 04 BF    ................
022470:  03 DA B3 04 A6 01 DA 03 A8 01 DA B3 04 DA B3 04    ................
022480:  DA B3 04 DA B3 04 DA B3 04 A8 01 DA B3 04 A8 01    ................
022490:  DA B3 04 DA B3 04 DA B3 04 C0 03 DA B3 04 C0 03    ................
0224A0:  DA B3 04 A8 01 DA B3 04 DA B3 04 DA B3 04 DC B3    ................
0224B0:  04 DC B3 04 A8 01 DC B3 04 A8 01 DC B3 04 DC B3    ................
0224C0:  04 DC B3 04 C0 03 DC B3 04 C0 03 DC B3 04 FF DC    ................
0224D0:  03 DC B3 04 DC B3 04 DC B3 04 DA B3 04 DA B3 04    ................
0224E0:  A7 01 DA B3 04 A7 01 DA B3 04 DA B3 04 DA B3 04    ................
0224F0:  BF 03 DA B3 04 DA B3 04 DA B3 04 A7 01 DA B3 04    ................
022500:  DC B3 04 DC B3 04 DC B3 04 DC B3 04 A7 01 DC B3    ................
022510:  04 A7 01 DC B3 04 DC B3 04 DC B3 04 BF 03 DC B3    ................
022520:  04 DC B3 04 DC B3 04 A7 01 DC B3 04 DC B3 04 DC    ................
022530:  B3 04 DA B3 04 DA B3 04 A7 01 DA B3 04 A7 01 DA    ................
022540:  B3 04 DA B3 04 DA B3 04 BF 03 DA B3 04 A6 01 DA    ................
022550:  03 A8 01 DA B3 04 DA B3 04 DA B3 04 DC B3 04 DC    ................
022560:  B3 04 A8 01 DC B3 04 A8 01 DC B3 04 DC B3 04 DC    ................
022570:  B3 04 C0 03 DC B3 04 C0 03 DC B3 04 A8 01 DC B3    ................
022580:  04 DC B3 04 DC B3 04 DC B3 04 DC B3 04 A8 01 DC    ................
022590:  B3 04 A8 01 D7 B3 04 D7 B3 04 D7 B3 04 C0 03 DB    ................
0225A0:  B3 04 C0 03 DB B3 04 FF DB 03 DB B3 04 DB B3 04    ................
0225B0:  DB B3 04 DB B3 04 DB B3 04 A7 01 DB B3 04 A7 01    ................
0225C0:  DB B3 04 DA B3 04 DA B3 04 BF 03 DA B3 04 DA B3    ................
0225D0:  04 DA B3 04 A7 01 DA B3 04 DA B3 04 DA B3 04 DA    ................
0225E0:  B3 04 DA B3 04 A7 01 DA B3 04 A7 01 DA B3 04 DA    ................
0225F0:  B3 04 DA B3 04 BF 03 D8 B3 04 D8 B3 04 D8 B3 04    ................
022600:  47 86 49 84 4B 03 B2 00 CB B2 0F 4B 06 B2 00 CB    G.I.K......K....
022610:  B2 01 CB B2 01 CB B2 02 CB B2 02 CB B2 03 CB B2    ................
022620:  04 4B 02 B2 06 49 02 B2 00 4E 0A 02 CE B0 01 CE    .K...I...N......
022630:  B0 01 CE B0 02 CE B0 02 CE B0 03 4E 11 B0 04 4E    ...........N...N
022640:  02 02 4C 82 4B 82 47 82 44 82 4C 82 4B 82 FF A7    ..L.K.G.D.L.K...
022650:  01 E3 B3 04 E3 B3 04 E3 B3 04 E3 B3 04 E3 B3 04    ................
022660:  A7 01 E3 B3 04 A7 01 E3 B3 04 E3 B3 04 E3 B3 04    ................
022670:  BF 03 E3 B3 04 E3 B3 04 E3 B3 04 A7 01 E3 B3 04    ................
022680:  E3 B3 04 E3 B3 04 E3 B3 04 E3 B3 04 A7 01 E3 B3    ................
022690:  04 A7 01 E3 B3 04 E3 B3 04 E3 B3 04 BF 03 E3 B3    ................
0226A0:  04 E3 B3 04 E3 B3 04 A7 01 E3 B3 04 E3 B3 04 E3    ................
0226B0:  B3 04 E3 B3 04 E3 B3 04 A7 01 E3 B3 04 A7 01 E3    ................
0226C0:  B3 04 E3 B3 04 E3 B3 04 BF 03 E3 B3 04 E3 B3 04    ................
0226D0:  E3 B3 04 A8 01 D8 B3 04 D8 B3 04 D8 B3 04 D8 B3    ................
0226E0:  04 D8 B3 04 A8 01 D8 B3 04 A8 01 D8 B3 04 D8 B3    ................
0226F0:  04 D8 B3 04 C0 03 D8 B3 04 C0 03 D8 B3 04 A8 01    ................
022700:  D8 B3 04 D8 B3 04 D8 B3 04 D8 B3 04 D8 B3 04 A8    ................
022710:  01 D8 B3 04 A8 01 D8 B3 04 D8 B3 04 D8 B3 04 C0    ................
022720:  03 D5 B3 04 C0 03 D5 B3 04 FF A7 01 E3 B3 04 E3    ................
022730:  B3 04 E3 B3 04 E3 B3 04 E3 B3 04 A7 01 E3 B3 04    ................
022740:  A7 01 E3 B3 04 E3 B3 04 E3 B3 04 BF 03 E3 B3 04    ................
022750:  E3 B3 04 E3 B3 04 A7 01 E3 B3 04 E3 B3 04 E3 B3    ................
022760:  04 E3 B3 04 E3 B3 04 A7 01 E3 B3 04 A7 01 E3 B3    ................
022770:  04 E3 B3 04 E3 B3 04 BF 03 E3 B3 04 E3 B3 04 E3    ................
022780:  B3 04 A7 01 E3 B3 04 E3 B3 04 E3 B3 04 E3 B3 04    ................
022790:  E3 B3 04 A7 01 E3 B3 04 A7 01 E3 B3 04 E3 B3 04    ................
0227A0:  E3 B3 04 BF 03 E3 B3 04 E3 B3 04 E3 B3 04 A8 01    ................
0227B0:  D8 B3 04 D8 B3 04 D8 B3 04 D8 B3 04 D8 B3 04 A8    ................
0227C0:  01 D8 B3 04 A8 01 D8 B3 04 D8 B3 04 D8 B3 04 C0    ................
0227D0:  03 D8 B3 04 C0 03 D8 B3 04 A8 01 D8 B3 04 D8 B3    ................
0227E0:  04 D8 B3 04 D8 B3 04 D8 B3 04 A8 01 D8 B3 04 A8    ................
0227F0:  01 D8 B3 04 D8 B3 04 D8 B3 04 C0 03 D5 B3 04 C0    ................
022800:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
022810:  1D 00 01 00 02 09 4E E5 1D 00 C1 02 00 00 00 02    ......N.........
022820:  1D 00 C6 02 00 00 00 02 1D 00 C2 02 00 00 00 02    ................
022830:  1D 00 C7 02 00 00 00 02 1D 00 C3 02 00 00 00 02    ................
022840:  1D 00 C8 02 00 00 00 02 1D 00 C4 02 00 00 00 02    ................
022850:  1D 00 C9 02 00 00 00 02 1D 00 C5 02 00 00 00 02    ................
022860:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
022870:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
022880:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
022890:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0228A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0228B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0228C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0228D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0228E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0228F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
022900:  A7 01 D8 B3 04 D8 B3 04 D8 B3 04 D8 B3 04 D8 B3    ................
022910:  04 A7 01 D8 B3 04 A7 01 D8 B3 04 D8 B3 04 D8 B3    ................
022920:  04 D7 03 D7 B3 04 A6 01 D7 03 A8 01 D7 B3 04 D7    ................
022930:  B3 04 D7 B3 04 D7 B3 04 D7 B3 04 A8 01 D7 B3 04    ................
022940:  A8 01 D7 B3 04 D7 B3 04 D7 B3 04 C0 03 D8 B3 04    ................
022950:  C0 03 D8 B3 04 A8 01 D8 B3 04 D8 B3 04 D8 B3 04    ................
022960:  D8 B3 04 D8 B3 04 A8 01 D8 B3 04 A8 01 D8 B3 04    ................
022970:  D8 B3 04 D8 B3 04 C0 03 DA B3 04 C0 03 DA B3 04    ................
022980:  FF DA 03 DA B3 04 DA B3 04 DA B3 04 DA B3 04 DA    ................
022990:  B3 04 A7 01 DA B3 04 A7 01 DA B3 04 DA B3 04 D7    ................
0229A0:  B3 04 BF 01 D7 B3 04 D7 B3 04 D7 B3 04 A7 01 D7    ................
0229B0:  B3 04 D7 B3 04 D7 B3 04 D7 B3 04 D7 B3 04 A7 01    ................
0229C0:  D7 B3 04 A7 01 D7 B3 04 D7 B3 04 D7 B3 04 BF 03    ................
0229D0:  D7 B3 04 D7 B3 04 D7 B3 04 A7 01 D7 B3 04 D7 B3    ................
0229E0:  04 D7 B3 04 D7 B3 04 D7 B3 04 A7 01 D7 B3 04 A7    ................
0229F0:  01 D7 B3 04 D7 B3 04 D7 B3 04 BF 03 D8 B3 04 A6    ................
022A00:  01 D8 03 A8 01 D8 B3 04 D8 B3 04 D8 B3 04 D8 B3    ................
022A10:  04 D8 B3 04 A8 01 D8 B3 04 A8 01 D8 B3 04 D8 B3    ................
022A20:  04 D8 B3 04 C0 03 DA B3 04 C0 03 DA B3 04 A8 01    ................
022A30:  DA B3 04 DA B3 04 DA B3 04 DA B3 04 DA B3 04 A8    ................
022A40:  01 DA B3 04 A8 01 DA B3 04 DA B3 04 DA B3 04 C0    ................
022A50:  03 DC B3 04 C0 03 DC B3 04 FF DC 03 DC B3 04 DC    ................
022A60:  B3 04 DC B3 04 DC B3 04 DC B3 04 A7 01 DC B3 04    ................
022A70:  A7 01 DC B3 04 DC B3 04 DC B3 04 BF 03 DC B3 04    ................
022A80:  DC B3 04 DC B3 04 A7 01 DC B3 04 DC B3 05 DC B3    ................
022A90:  05 DA B3 05 DA B3 05 A7 01 DA B3 05 A7 01 DA B3    ................
022AA0:  05 DA B3 05 DA B3 05 BF 03 DA B3 05 DA B3 05 DA    ................
022AB0:  B3 05 A7 01 DA B3 06 DA B3 06 DA B3 06 D7 B3 06    ................
022AC0:  D7 B3 04 A7 01 D7 B3 06 A7 01 D7 B3 06 D7 B3 06    ................
022AD0:  D7 B3 06 BF 03 D7 B3 06 A6 01 D7 03 A8 01 D7 B3    ................
022AE0:  06 D7 B3 06 D7 B3 06 D7 B3 06 D7 B3 06 A8 01 D7    ................
022AF0:  B3 07 A8 01 D7 B3 07 D7 B3 07 D7 B3 07 C0 03 D7    ................
022B00:  00 2D 47 57 4C 49 4E 4B 20 42 41 53 00 00 00 00    .-GWLINK BAS....
022B10:  00 00 00 00 00 70 01 00 29 01 00 00 00 00 00 00    .....p..).......
022B20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
022B30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
022B40:  29 01 00 B4 03 30 2C 30 30 2C 30 31 2C 36 30 2C    )....0,00,01,60,
022B50:  31 30 2C 45 44 2C 42 30 2C 43 33 2C 30 30 2C 30    10,ED,B0,C3,00,0
022B60:  38 00 0A 00 46 00 83 20 1C 80 BE 00 00 00 1A 80    8...F.. ........
022B70:  BE 00 00 00 1A 00 00 00 00 00 00 00 00 00 00 00    ................
022B80:  23 00 01 00 01 C0 20 47 68 6F 75 6C 27 73 20 77    #..... Ghoul's w
022B90:  72 69 74 65 72 20 6C 69 6E 6B 65 72 20 76 20 31    riter linker v 1
022BA0:  2E 30 00 07 00 02 00 01 C0 00 24 00 03 00 01 C0    .0........$.....
022BB0:  20 54 6F 6D 20 65 74 20 4A 65 72 72 79 20 6F 66     Tom et Jerry of
022BC0:  20 47 50 41 20 28 63 29 20 31 39 39 34 00 07 00     GPA (c) 1994...
022BD0:  04 00 01 C0 00 20 00 0A 00 83 20 1C 4E BB 01 86    ..... .... .N...
022BE0:  01 AA 20 1F 00 00 09 25 90 01 B7 22 64 22 01 AA    .. ....%..."d"..
022BF0:  20 1C FF 3F 00 19 00 14 00 A8 20 22 6D 6F 72 65     ..?...... "more
022C00:  2D 63 68 72 2E 64 61 74 22 2C 1C F8 8E 00 16 00    -chr.dat",......
022C10:  1E 00 A8 20 22 69 6E 74 72 6F 2E 64 61 74 22 2C    ... "intro.dat",
022C20:  1C 00 90 00 17 00 28 00 A8 20 22 67 77 6C 69 6E    ......(.. "gwlin
022C30:  6B 2E 62 69 6E 22 2C 1C 00 40 00 32 00 32 00 9E    k.bin",..@.2.2..
022C40:  20 0D 00 00 E9 EF 1C 80 BE 20 EC 20 1C 8D BE 01     ........ . ....
022C50:  C3 20 03 00 00 E1 01 BE 20 0D 00 00 E9 2C FF 1D    . ...... ....,..
022C60:  28 22 26 22 F4 03 00 00 E1 29 01 B0 00 30 00 3C    ("&".....)...0.<
022C70:  00 8C 20 32 31 2C 30 30 2C 34 30 2C 31 31 2C 34    .. 21,00,40,11,4
022C80:  30 2C 30 30 2C 30 31 2C 36 30 2C 31 30 2C 45 44    0,00,01,60,10,ED
022C90:  2C 42 30 2C 43 33 2C 30 30 2C 30 38 00 0A 00 46    ,B0,C3,00,08...F
022CA0:  00 83 20 1C 80 BE 00 00 00 1A 80 BE 00 00 00 1A    .. .............
022CB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
022CC0:  DA 00 00 14 05 01 C3 20 03 00 00 E1 01 BE 20 0D    ....... ...... .
022CD0:  00 00 E9 2C FF 1D 28 22 26 22 F4 03 00 00 E1 29    ...,..("&".....)
022CE0:  01 B0 00 30 00 46 00 8C 20 32 31 2C 30 30 2C 34    ...0.F.. 21,00,4
022CF0:  30 2C 31 31 2C 34 30 2C 30 30 2C 30 31 2C 30 30    0,11,40,00,01,00
022D00:  B3 08 C0 03 D7 B3 09 A8 01 D7 B3 0A D7 B3 0B D7    ................
022D10:  B3 0C D7 B3 0D D7 B3 0E A8 01 D7 B3 0F A8 01 D7    ................
022D20:  B3 0F D7 B3 0F D7 B3 0F C0 03 D7 B3 0F C0 03 D7    ................
022D30:  B3 0F FF DA 03 DA B3 04 DC B3 04 DA B3 04 DC B3    ................
022D40:  04 DC B3 04 A7 01 DC B3 04 A7 01 DC B3 04 DC B3    ................
022D50:  04 DC B3 04 BF 03 DC B3 04 DC B3 04 DC B3 04 A7    ................
022D60:  01 DC B3 04 D5 B3 04 D5 B3 04 D5 B3 04 D5 B3 04    ................
022D70:  A7 01 D5 B3 04 A7 01 D5 B3 04 D5 B3 04 D5 B3 04    ................
022D80:  BF 03 D5 B3 04 D5 B3 04 D5 B3 04 A7 01 D5 B3 04    ................
022D90:  D5 B3 04 D5 B3 04 DA B3 04 DA B3 04 A7 01 DA B3    ................
022DA0:  04 A7 01 DA B3 04 DA B3 04 DA B3 04 BF 03 DA B3    ................
022DB0:  04 A6 01 DA 03 A8 01 DA B3 04 DA B3 04 DA B3 04    ................
022DC0:  DA B3 04 DA B3 04 A8 01 DA B3 04 A8 01 DA B3 04    ................
022DD0:  DA B3 04 DA B3 04 C0 03 DA B3 04 C0 03 DA B3 04    ................
022DE0:  A8 01 DA B3 04 DA B3 04 DA B3 04 DC B3 04 DC B3    ................
022DF0:  04 A8 01 DC B3 04 A8 01 DC B3 04 DC B3 04 DC B3    ................
022E00:  04 C0 03 DC B3 04 C0 03 DC B3 04 FF 1A FF 00 FF    ................
022E10:  20 00 75 30 00 00 00 00 00 00 00 B7 3B 0B 24 00     .u0........;.$.
022E20:  00 66 20 00 75 30 00 00 00 00 00 00 00 B7 3B 0B    .f .u0........;.
022E30:  1A 3B 00 00 00 00 00 00 00 67 3B 00 00 00 00 00    .;.......g;.....
022E40:  00 00 75 30 00 00 00 00 00 00 00 67 3B 00 00 00    ..u0.......g;...
022E50:  00 00 00 00 75 30 00 00 00 00 00 00 00 67 3B 00    ....u0.......g;.
022E60:  1A 00 00 00 75 30 00 00 00 00 00 00 00 67 3B 0B    ....u0.......g;.
022E70:  1A 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
022E80:  DC B3 04 DC B3 04 A7 01 DC B3 04 DC B3 05 DC B3    ................
022E90:  05 DA B3 05 DA B3 05 A7 01 DA B3 05 A7 01 DA B3    ................
022EA0:  05 DA B3 05 DA B3 05 BF 03 DA B3 05 DA B3 05 DA    ................
022EB0:  B3 05 A7 01 DA B3 06 DA B3 06 DA B3 06 D7 B3 06    ................
022EC0:  D7 B3 04 A7 01 D7 B3 06 A7 01 D7 B3 06 D7 B3 06    ................
022ED0:  D7 B3 06 BF 03 D7 B3 06 A6 01 D7 03 A8 01 D7 B3    ................
022EE0:  06 D7 B3 06 D7 B3 06 D7 B3 06 D7 B3 06 A8 01 D7    ................
022EF0:  B3 07 A8 01 D7 B3 07 D7 B3 07 D7 B3 07 C0 03 D7    ................
022F00:  07 01 F3 00 07 01 20 00 07 01 01 08 01 08 01 00    ...... .........
022F10:  01 00 0A 01 00 1A 01 0B 01 00 1A 01 0C 01 00 1A    ................
022F20:  01 0D 01 00 1A 01 0E 01 00 1A 01 0F 01 00 1A 01    ................
022F30:  10 01 00 1A 01 11 01 00 1A 01 13 01 00 1A 01 14    ................
022F40:  01 00 1A 01 15 01 00 1A 01 17 01 00 01 00 07 28    ...............(
022F50:  00 01 01 08 28 00 1A 01 09 28 00 1A 01 0A 28 00    ....(....(....(.
022F60:  1A 01 0B 28 00 1A 01 0C 28 00 1A 01 0D 28 00 1A    ...(....(....(..
022F70:  01 0E 28 00 1A 01 0F 28 00 1A 01 10 28 00 1A 01    ..(....(....(...
022F80:  11 28 00 1A 01 12 28 00 1A 01 13 28 00 1A 01 14    .(....(....(....
022F90:  28 00 1A 01 15 28 00 1A 01 16 28 00 1A 01 17 28    (....(....(....(
022FA0:  00 1A 01 05 01 1A 1A 1A 1A 1A 1A 1A 1A 11 14 00    ................
022FB0:  00 01 00 01 02 03 04 05 06 07 07 09 0A 0B 0C 0D    ................
022FC0:  0E 0F 05 01 1A 1A 1A 1A 1A 1A 1A 1A 11 14 00 00    ................
022FD0:  01 00 01 02 03 04 05 06 07 07 09 0A 0B 0C 0D 0E    ................
022FE0:  0F 07 03 43 75 72 73 6F 72 20 73 70 65 65 64 00    ...Cursor speed.
022FF0:  08 03 43 75 72 73 6F 72 20 76 69 73 69 62 6C 65    ..Cursor visible
023000:  00 0A 03 54 65 78 74 6C 69 6E 65 20 31 20 63 6F    ...Textline 1 co
023010:  6C 6F 72 00 0B 03 54 65 78 74 6C 69 6E 65 20 32    lor...Textline 2
023020:  20 63 6F 6C 6F 72 00 0C 03 54 65 78 74 6C 69 6E     color...Textlin
023030:  65 20 33 20 63 6F 6C 6F 72 00 0D 03 54 65 78 74    e 3 color...Text
023040:  6C 69 6E 65 20 34 20 63 6F 6C 6F 72 00 0E 03 54    line 4 color...T
023050:  65 78 74 6C 69 6E 65 20 35 20 63 6F 6C 6F 72 00    extline 5 color.
023060:  0F 03 54 65 78 74 6C 69 6E 65 20 36 20 63 6F 6C    ..Textline 6 col
023070:  6F 72 00 10 03 54 65 78 74 6C 69 6E 65 20 37 20    or...Textline 7 
023080:  63 6F 6C 6F 72 00 11 03 54 65 78 74 6C 69 6E 65    color...Textline
023090:  20 38 20 63 6F 6C 6F 72 00 13 03 43 6F 6C 6F 72     8 color...Color
0230A0:  20 46 78 00 14 03 52 6F 64 73 20 63 6F 6C 6F 72     Fx...Rods color
0230B0:  00 15 03 50 61 70 65 72 20 74 65 78 74 20 63 6F    ...Paper text co
0230C0:  6C 6F 72 00 17 03 53 70 61 63 65 20 6D 65 73 73    lor...Space mess
0230D0:  61 67 65 00 07 2A 4C 6F 67 6F 20 6D 6F 64 65 00    age..*Logo mode.
0230E0:  08 2A 4C 6F 67 6F 20 63 6F 6C 6F 72 20 30 00 09    .*Logo color 0..
0230F0:  2A 4C 6F 67 6F 20 63 6F 6C 6F 72 20 31 00 0A 2A    *Logo color 1..*
023100:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
023110:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
023120:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
023130:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
023140:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
023150:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
023160:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
023170:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
023180:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
023190:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0231A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0231B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0231C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0231D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0231E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0231F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
023200:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
023210:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
023220:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
023230:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
023240:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
023250:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
023260:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
023270:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
023280:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
023290:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0232A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0232B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0232C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0232D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0232E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0232F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
023300:  00 42 4F 49 4E 47 20 20 20 47 57 58 00 00 00 00    .BOING   GWX....
023310:  00 00 02 00 00 00 96 00 00 04 00 00 00 00 00 00    ................
023320:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023330:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023340:  00 04 00 65 03 00 00 42 4F 49 4E 47 20 20 20 24    ...e...BOING   $
023350:  24 24 FF 00 FF 46 43 40 3C 39 36 33 30 2D 2A 28    $$...FC@<9630-*(
023360:  25 22 20 1E 1B 19 17 15 13 11 0F 0E 0C 0B 0A 08    %" .............
023370:  07 06 05 05 04 03 03 03 02 02 02 02 03 03 03 04    ................
023380:  C3 07 96 C3 49 96 C9 21 00 9A 11 06 C2 3E 90 73    ....I..!.....>.s
023390:  23 72 23 EB 01 00 08 09 30 04 01 4A C0 09 EB 3D    #r#.....0..J...=
0233A0:  20 ED 21 AE 96 06 49 1E 08 16 02 AF 77 23 73 23     .!...I.....w#s#
0233B0:  77 23 72 3C 23 10 F5 06 49 70 23 36 02 23 70 23    w#r<#...Ip#6.#p#
0233C0:  36 08 23 10 F4 3E FF 77 C9 3E 10 DD 21 80 99 08    6.#..>.w.>..!...
0233D0:  DD 6E 04 DD 66 05 7E E6 F0 77 DD 6E 00 DD 66 01    .n..f.~..w.n..f.
0233E0:  7E FE FF 20 04 21 AE 96 7E 5F 23 7E 57 23 DD 75    ~.. .!..~_#~W#.u
0233F0:  00 DD 74 01 DD 6E 02 DD 66 03 7E FE FF 20 04 21    ..t..n..f.~.. .!
023400:  10 99 7E 23 DD 75 02 DD 74 03 21 00 9A 87 4F 06    ..~#.u..t.!...O.
023410:  00 09 4E 23 46 6B 26 00 09 7E E6 F0 82 77 DD 75    ..N#Fk&..~...w.u
023420:  04 DD 74 05 08 01 06 00 DD 09 3D 20 A2 C9 00 00    ..t.......= ....
023430:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023440:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023450:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023460:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023470:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023480:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023490:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0234A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0234B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0234C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0234D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0234E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0234F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023500:  00 2D 47 57 44 45 4D 4F 20 42 41 53 00 00 00 00    .-GWDEMO BAS....
023510:  00 00 00 00 00 70 01 00 5E 00 00 00 00 00 00 00    .....p..^.......
023520:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023530:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023540:  5E 00 00 13 04 15 00 0A 00 83 20 1C 4E BB 01 86    ^......... .N...
023550:  01 AA 20 1F 00 00 09 25 90 00 22 00 14 00 B7 22    .. ....%.."...."
023560:  64 22 01 AA 20 1C F2 11 01 A8 20 22 67 77 64 65    d".. ..... "gwde
023570:  6D 6F 2E 62 69 6E 22 2C 1C FE 7E 00 0A 00 1E 00    mo.bin",..~.....
023580:  15 00 0A 00 83 20 1C 4E BB 01 86 01 AA 20 1F 00    ..... .N..... ..
023590:  00 09 25 90 00 22 00 14 00 B7 22 64 22 01 AA 20    ..%.."...."d".. 
0235A0:  1C F2 11 01 A8 20 22 67 77 64 65 6D 6F 2E 62 69    ..... "gwdemo.bi
0235B0:  6E 22 2C 1C FE 7E 00 0A 00 1E 00 83 20 1C 80 A0    n",..~...... ...
0235C0:  00 1B 00 28 00 AD 20 0F 01 BF 20 22 46 69 6E 65    ...(.. ... "Fine
0235D0:  2C 20 6E 6F 20 3F 22 01 BF 01 98 00 00 00 1A 1A    , no ?".........
0235E0:  95 A5 02 00 96 A5 02 00 97 A5 04 00 9A A5 02 00    ................
0235F0:  9B A5 03 00 9D A5 02 00 9E A5 03 00 A0 A5 02 00    ................
023600:  00 47 57 44 45 4D 4F 20 20 42 49 4E 00 00 00 46    .GWDEMO  BIN...F
023610:  96 97 98 99 9A 9B 9C 9D 9E 00 00 00 00 00 00 00    ................
023620:  00 46 49 56 45 20 20 20 20 46 4E 54 00 00 00 07    .FIVE    FNT....
023630:  A0 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023640:  00 4C 49 4E 45 4F 55 54 20 46 4E 54 00 00 00 07    .LINEOUT FNT....
023650:  4F 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    O...............
023660:  00 47 57 2D 43 4C 49 50 20 53 43 52 00 00 00 80    .GW-CLIP SCR....
023670:  A3 A4 A5 A6 A7 A8 A9 AA AB AC AD AE AF B0 B1 B2    £...............
023680:  00 41 43 43 45 4E 54 53 20 44 41 54 00 00 00 02    .ACCENTS DAT....
023690:  A2 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0236A0:  00 47 57 2D 43 4C 49 50 20 53 43 52 01 00 00 01    .GW-CLIP SCR....
0236B0:  B3 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0236C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0236D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0236E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0236F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
023700:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023710:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023720:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023730:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023740:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023750:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023760:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023770:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023780:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023790:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0237A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0237B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0237C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0237D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0237E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0237F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023800:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023810:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023820:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023830:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023840:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023850:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023860:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023870:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023880:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 7E    ...............~
023890:  7D 79 75 71 6E 6A 66 62 5F 5B 58 54 51 4D 4A 46    }yuqnjfb_[XTQMJF
0238A0:  43 40 3C 39 36 33 30 2D 2A 28 25 22 20 1E 1B 19    C@<9630-*(%" ...
0238B0:  17 15 13 11 0F 0E 0C 0B 0A 08 07 06 05 05 04 03    ................
0238C0:  03 03 02 02 02 02 03 03 03 04 05 06 06 07 09 0A    ................
0238D0:  0B 0D 0E 10 12 14 15 18 1A 1C 1E 21 23 26 28 2B    ...........!#&(+
0238E0:  2E 31 34 37 3A 3D 41 44 47 4B 4E 51 55 59 5C 60    .147:=ADGKNQUY\`
0238F0:  64 67 6B 6F 72 76 7A 7C FF 00 00 00 00 00 00 00    dgkorvz|........
023900:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023910:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023920:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023930:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023940:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023950:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023960:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023970:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023980:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023990:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0239A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0239B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0239C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0239D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0239E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0239F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023A00:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023A10:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023A20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023A30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023A40:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023A50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023A60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023A70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023A80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023A90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023AA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023AB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023AC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023AD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023AE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023AF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023B00:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
023B10:  1E 00 01 00 02 09 4E E5 1E 00 C1 02 00 00 00 02    ......N.........
023B20:  1E 00 C6 02 00 00 00 02 1E 00 C2 02 00 00 00 02    ................
023B30:  1E 00 C7 02 00 00 00 02 1E 00 C3 02 00 00 00 02    ................
023B40:  1E 00 C8 02 00 00 00 02 1E 00 C4 02 00 00 00 02    ................
023B50:  1E 00 C9 02 00 00 00 02 1E 00 C5 02 00 00 00 02    ................
023B60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023B70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023B80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023B90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023BA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023BB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023BC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023BD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023BE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023BF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023C00:  AE 96 10 99 06 C2 A8 97 20 99 06 C2 AC 98 30 99    ........ .....0.
023C10:  06 C2 F8 97 47 99 06 C2 6C 97 67 99 06 C2 BA 97    ....G...l.g.....
023C20:  70 99 06 C2 76 98 1C 99 06 C2 42 97 55 99 06 C2    p...v.....B.U...
023C30:  0A 97 2B 99 06 C2 40 98 72 99 06 C2 BE 96 32 99    ..+...@.r.....2.
023C40:  06 C2 1C 97 47 99 06 C2 CE 98 37 99 06 C2 92 97    ....G.....7.....
023C50:  30 99 06 C2 0E 98 6C 99 06 C2 EE 96 2D 99 06 C2    0.....l.....-...
023C60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023C70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023C80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023C90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023CA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023CB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023CC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023CD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023CE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023CF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023D00:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023D10:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023D20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023D30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023D40:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023D50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023D60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023D70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
023D80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 7E    ...............~
023D90:  7D 79 75 71 6E 6A 66 62 5F 5B 58 54 51 4D 4A 46    }yuqnjfb_[XTQMJF
023DA0:  43 40 3C 39 36 33 30 2D 2A 28 25 22 20 1E 1B 19    C@<9630-*(%" ...
023DB0:  17 15 13 11 0F 0E 0C 0B 0A 08 07 06 05 05 04 03    ................
023DC0:  03 03 02 02 02 02 03 03 03 04 05 06 06 07 09 0A    ................
023DD0:  0B 0D 0E 10 12 14 15 18 1A 1C 1E 21 23 26 28 2B    ...........!#&(+
023DE0:  2E 31 34 37 3A 3D 41 44 47 4B 4E 51 55 59 5C 60    .147:=ADGKNQUY\`
023DF0:  64 67 6B 6F 72 76 7A 7C FF 00 00 00 00 00 00 00    dgkorvz|........
023E00:  7E DD 77 19 E1 3E 01 CB 7E 20 0D 23 7E CB 7F 28    ~.w..>..~ .#~..(
023E10:  07 E6 7F DD 77 06 18 53 DD 77 06 23 E5 7E F5 E6    ....w..S.w.#.~..
023E20:  0F DD BE 05 28 06 DD 77 05 DD 72 0A 87 87 87 5F    ....(..w..r...._
023E30:  21 42 64 19 50 59 ED A0 ED A0 ED A0 ED A0 ED A0    !Bd.PY..........
023E40:  ED A0 ED A0 ED A0 F1 E1 E6 F0 28 1F FE F0 CA A0    ..........(.....
023E50:  62 FE D0 CA BC 62 FE B0 CA C4 62 FE 80 D2 CC 62    b....b....b....b
023E60:  FE 10 20 07 AF DD 77 1B DD 77 09 23 DD 75 00 DD    .. ...w..w.#.u..
023E70:  74 01 DD 36 16 00 DD 36 17 20 DD 7E 17 B7 20 0E    t..6...6. .~.. .
023E80:  DD 7E 15 B7 C8 DD 77 17 DD 7E 14 DD 77 16 16 00    .~....w..~..w...
023E90:  DD 5E 16 DD 34 16 DD 35 17 DD 7E 1B B7 28 1A 67    .^..4..5..~..(.g
023EA0:  DD 6E 1A 19 7E DD 46 07 80 87 42 4F 21 0C 63 09    .n..~.F...BO!.c.
023EB0:  7E DD 77 18 23 7E DD 77 19 DD 66 0F DD 6E 0E 19    ~.w.#~.w..f..n..
023EC0:  19 4E 23 46 DD 6E 18 DD 66 19 09 4D DD 7E 02 CD    .N#F.n..f..M.~..
023ED0:  E4 62 4C DD 7E 03 CD E4 62 DD 66 11 DD 6E 10 19    .bL.~...b.f..n..
023EE0:  7E CB 7F 20 12 E6 0F DD 96 0A 30 01 AF DD B6 09    ~.. ......0.....
023EF0:  4F DD 7E 04 CD E4 62 DD 6E 12 DD 66 13 19 7E CB    O.~...b.n..f..~.
023F00:  7F C0 E6 1F DD 46 0B 4F B7 78 28 08 47 79 32 CF    .....F.O.x(.Gy2.
023F10:  60 78 D6 40 32 9B 62 3A C0 60 CB 47 32 C0 60 C9    `x.@2.b:.`.G2.`.
023F20:  23 7E E5 87 06 00 4F 21 C2 64 09 5E 23 56 DD 73    #~....O!.d.^#V.s
023F30:  1A DD 72 1B DD 36 09 00 E1 C3 EB 61 23 7E 32 BB    ..r..6.....a#~2.
023F40:  60 C3 EB 61 23 7E DD 77 0A C3 EB 61 DD 36 09 10    `..a#~.w...a.6..
023F50:  DD 36 1B 00 7E 0F 0F 0F 0F 32 ED 60 23 7E 32 DE    .6..~....2.`#~2.
023F60:  60 C3 EB 61 06 F4 ED 79 06 F6 ED 78 F6 C0 ED 79    `..a...y...x...y
023F70:  E6 3F ED 79 06 F4 ED 49 06 F6 4F F6 80 ED 79 ED    .?.y...I..O...y.
023F80:  49 C9 FF FF FF FF E2 66 24 67 66 67 EE 0E 18 0E    I......f$gfg....
023F90:  4D 0D 8E 0C DA 0B 2F 0B 8F 0A F7 09 68 09 E1 08    M...../.....h...
023FA0:  61 08 E9 07 77 07 0C 07 A7 06 47 06 ED 05 98 05    a...w.....G.....
023FB0:  47 05 FC 04 B4 04 70 04 31 04 F4 03 BC 03 86 03    G.....p.1.......
023FC0:  53 03 24 03 F6 02 CC 02 A4 02 7E 02 5A 02 38 02    S.$.......~.Z.8.
023FD0:  18 02 FA 01 DE 01 C3 01 AA 01 92 01 7B 01 66 01    ............{.f.
023FE0:  52 01 3F 01 2D 01 1C 01 0C 01 FD 00 EF 00 E1 00    R.?.-...........
023FF0:  D5 00 C9 00 BE 00 B3 00 A9 00 9F 00 96 00 8E 00    ................
024000:  23 10 F7 79 A7 28 0D 7E A7 20 02 18 18 EB 36 09    #..y.(.~. ....6.
024010:  23 71 23 EB 7E A7 28 06 7E 12 23 13 18 F6 1B 1A    #q#.~.(.~.#.....
024020:  FE 20 28 FA 13 3E 0D 12 13 6B 62 22 05 95 C9 CD    . (..>...kb"....
024030:  09 88 21 70 96 CD 06 88 AF CD 18 BB FE FC C0 3E    ..!p...........>
024040:  FF C9 CD 09 88 2A 05 95 01 F4 11 7D B9 20 0D 7C    .....*.....}. .|
024050:  B8 20 09 21 E5 96 CD 06 88 C3 0C 88 2A 05 95 2B    . .!........*..+
024060:  7E FE 0D 28 FA 23 23 36 0A 22 05 95 21 B0 96 CD    ~..(.##6."..!...
024070:  06 88 CD 18 BB FE FC 20 09 CD 09 88 CD 0F 88 C3    ....... ........
024080:  0C 88 21 14 88 11 64 96 01 08 00 ED B0 3A 5A BB    ..!...d......:Z.
024090:  32 08 95 3E C9 32 5A BB 21 64 96 06 0C 11 00 C0    2..>.2Z.!d......
0240A0:  CD 8C BC 30 21 11 F3 11 2A 05 95 01 0C EE 09 23    ...0!...*......#
0240B0:  23 EB 01 00 00 3E 02 CD 98 BC 30 0A CD 8F BC 30    #....>....0....0
0240C0:  05 CD 09 88 18 12 CD 92 BC CD 09 88 3A 08 95 32    ............:..2
0240D0:  5A BB 21 FD 96 CD 06 88 3A 08 95 32 5A BB CD 0F    Z.!.....:..2Z...
0240E0:  88 C3 0C 88 20 20 20 20 20 20 20 20 2E 47 57 43    ....        .GWC
0240F0:  07 01 57 61 72 6E 69 6E 67 20 21 20 43 6F 6E 76    ..Warning ! Conv
024100:  65 72 74 20 77 69 6C 6C 20 65 72 61 73 65 20 74    ert will erase t
024110:  65 78 74 20 69 6E 20 6D 65 6D 6F 72 79 2E 2E 2E    ext in memory...
024120:  20 28 45 53 43 20 74 6F 20 61 62 6F 72 74 29 00     (ESC to abort).
024130:  07 01 50 72 65 73 73 20 61 20 6B 65 79 20 74 6F    ..Press a key to
024140:  20 73 61 76 65 20 63 6F 6E 76 65 72 74 65 64 20     save converted 
024150:  74 65 78 74 20 28 45 53 43 20 74 6F 20 63 61 6E    text (ESC to can
024160:  63 65 6C 29 00 07 01 4E 6F 20 74 65 78 74 20 74    cel)...No text t
024170:  6F 20 63 6F 6E 76 65 72 74 2E 2E 2E 00 07 01 53    o convert......S
024180:  61 76 69 6E 67 20 65 72 72 6F 72 2E 2E 2E 00 07    aving error.....
024190:  01 45 72 72 6F 72 2E 2E 2E 20 20 46 69 6C 65 20    .Error...  File 
0241A0:  68 61 73 20 6E 6F 20 6E 61 6D 65 2E 2E 2E 00 00    has no name.....
0241B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0241C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0241D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0241E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0241F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
024200:  86 00 7F 00 77 00 71 00 6A 00 64 00 5F 00 59 00    ....w.q.j.d._.Y.
024210:  54 00 50 00 4B 00 47 00 43 00 3F 00 3C 00 38 00    T.P.K.G.C.?.<.8.
024220:  35 00 32 00 2F 00 2D 00 2A 00 28 00 26 00 24 00    5.2./.-.*.(.&.$.
024230:  22 00 20 00 1E 00 1C 00 1B 00 19 00 18 00 16 00    ". .............
024240:  15 00 14 00 13 00 12 00 11 00 10 00 0F 00 00 00    ................
024250:  00 00 00 00 00 00 00 00 00 00 00 00 00 01 08 00    ................
024260:  00 00 00 00 00 DF 00 00 00 00 00 00 00 00 00 00    ................
024270:  00 00 00 00 00 00 00 00 02 03 09 00 00 00 00 00    ................
024280:  00 E7 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
024290:  00 00 00 00 04 05 0A 00 00 00 00 00 00 EF 00 00    ................
0242A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0242B0:  00 00 00 00 00 00 00 00 53 54 2D 4D 6F 64 75 6C    ........ST-Modul
0242C0:  65 2E E2 64 22 65 42 65 08 00 62 65 A2 65 C2 65    e..d"eBe..be.e.e
0242D0:  00 00 E2 65 22 66 42 65 10 10 E2 64 42 66 62 66    ...e"fBe...dBfbf
0242E0:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
0242F0:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
024300:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
024310:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
024320:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
024330:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
024340:  00 00 82 66 A2 66 C2 66 DC 5E DC 5E DC 5E DC 5E    ...f.f.f.^.^.^.^
024350:  DC 5E DC 5E DC 5E DC 5E DC 5E DC 5E DC 5E DC 5E    .^.^.^.^.^.^.^.^
024360:  DC 5E 00 00 00 00 00 00 00 00 00 00 00 00 00 00    .^..............
024370:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
024380:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
024390:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0243A0:  00 00 0F 0E 0D 0C 0B 0A 0A 0A 0A 0A 0A 0A 0A 0A    ................
0243B0:  0A 0A 0A 0A 0A 0A 0A 0A 09 08 07 06 05 04 03 02    ................
0243C0:  01 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0243D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0243E0:  00 00 80 00 00 01 80 01 00 02 80 02 00 03 00 04    ................
0243F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
024400:  00 43 4C 41 53 53 49 43 20 46 4E 54 00 00 00 00    .CLASSIC FNT....
024410:  00 00 02 00 00 00 7D 00 00 03 00 7D 00 00 00 00    ......}....}....
024420:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
024430:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
024440:  00 03 00 0C 04 00 00 43 4C 41 53 53 49 43 20 24    .......CLASSIC $
024450:  24 24 FF 00 FF 00 00 02 00 00 00 40 00 00 40 00    $$.........@..@.
024460:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
024470:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
024480:  00 00 00 00 00 00 00 00 18 18 18 18 18 00 18 00    ................
024490:  6C 6C 6C 00 00 00 00 00 6C 6C FE 6C FE 6C 6C 00    lll.....ll.l.ll.
0244A0:  18 3E 58 3C 1A 7C 18 00 00 C6 CC 18 30 66 C6 00    .>X<.|......0f..
0244B0:  38 6C 38 76 DC CC 76 00 18 18 30 00 00 00 00 00    8l8v..v...0.....
0244C0:  0C 18 30 30 30 18 0C 00 30 18 0C 0C 0C 18 30 00    ..000...0.....0.
0244D0:  00 66 3C FF 3C 66 00 00 00 18 18 7E 18 18 00 00    .f<.<f.....~....
0244E0:  00 00 00 00 00 18 18 30 00 00 00 7E 00 00 00 00    .......0...~....
0244F0:  00 00 00 00 00 18 18 00 06 0C 18 30 60 C0 80 00    ...........0`...
024500:  7C C6 CE D6 E6 C6 7C 00 18 38 18 18 18 18 7E 00    |.....|..8....~.
024510:  3C 66 06 3C 60 60 7E 00 3C 66 06 1C 06 66 3C 00    <f.<``~.<f...f<.
024520:  1C 3C 6C CC FE 0C 0C 00 7E 62 60 7C 06 66 3C 00    .<l.....~b`|.f<.
024530:  3C 66 60 7C 66 66 3C 00 7E 66 06 0C 18 18 18 00    <f`|ff<.~f......
024540:  3C 66 66 3C 66 66 3C 00 3C 66 66 3E 06 66 3C 00    <ff<ff<.<ff>.f<.
024550:  00 00 18 18 00 18 18 00 00 00 18 18 00 18 18 30    ...............0
024560:  0C 18 30 60 30 18 0C 00 00 00 7E 00 00 7E 00 00    ..0`0.....~..~..
024570:  60 30 18 0C 18 30 60 00 3C 66 66 0C 18 00 18 00    `0...0`.<ff.....
024580:  60 10 78 0C 7C CC 76 00 3C 66 66 66 7E 66 66 00    `.x.|.v.<fff~ff.
024590:  7C 66 66 7C 66 66 7C 00 7C C6 C0 C0 C0 C6 7C 00    |ff|ff|.|.....|.
0245A0:  F8 CC C6 C6 C6 C6 FC 00 FE C6 C0 F0 C0 C6 FE 00    ................
0245B0:  FE C2 C0 F0 C0 C0 C0 00 7C E6 C0 CE C6 E6 7C 00    ........|.....|.
0245C0:  C6 C6 C6 FE C6 C6 C6 00 3C 18 18 18 18 18 3C 00    ........<.....<.
0245D0:  06 06 06 06 C6 C6 7C 00 C6 C6 CC F8 CC C6 C6 00    ......|.........
0245E0:  60 60 60 60 60 66 7E 00 C6 EE FE FE D6 C6 C6 00    `````f~.........
0245F0:  C6 E6 F6 DE CE C6 C6 00 7C C6 C6 C6 C6 C6 7C 00    ........|.....|.
024600:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
024610:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
024620:  00 00 0F 0F 0E 0E 0D 0C 00 00 00 00 00 00 00 00    ................
024630:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
024640:  00 00 06 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
024650:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
024660:  00 00 01 00 01 00 01 00 01 00 00 00 00 00 00 00    ................
024670:  00 00 01 00 01 00 01 00 01 00 00 00 00 00 00 00    ................
024680:  00 00 01 00 01 00 01 00 01 00 00 00 00 00 00 00    ................
024690:  00 00 01 00 01 00 01 00 01 00 00 00 00 00 00 00    ................
0246A0:  00 00 0F 0E 0D 0C 80 80 80 80 80 80 80 80 80 80    ................
0246B0:  80 80 80 80 80 80 80 80 80 80 80 80 80 80 80 80    ................
0246C0:  80 80 0F 0D 0B 09 07 05 04 06 08 06 04 02 00 00    ................
0246D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0246E0:  00 00 07 0B 0F 13 17 1B 1F 13 08 03 00 00 00 00    ................
0246F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
024700:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
024710:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
024720:  00 00 00 03 07 0C 00 03 07 0C 00 03 07 0C 00 03    ................
024730:  07 0C 00 03 07 0C 00 03 07 0C 00 03 07 0C 00 03    ................
024740:  07 0C 00 04 07 0C 00 04 07 0C 00 04 07 0C 00 04    ................
024750:  07 0C 00 04 07 0C 00 04 07 0C 00 04 07 0C 00 04    ................
024760:  07 0C 00 A8 67 00 FC 67 00 FC 67 00 28 68 00 48    ....g..g..g.(h.H
024770:  68 00 FC 67 00 64 68 00 84 68 00 B2 68 00 B2 68    h..g.dh..h..h..h
024780:  00 B2 68 00 E4 68 00 06 69 00 2D 69 00 B6 69 00    ..h..h..i.-i..i.
024790:  38 6A 00 B9 6A 00 3A 6B 00 B9 6A 00 BB 6B 00 04    8j..j.:k..j..k..
0247A0:  6C 80 E2 66 00 53 6C 00 5B 6C 00 5B 6C 00 AF 6C    l..f.Sl.[l.[l..l
0247B0:  00 AF 6C 00 01 6D 00 62 6D 00 C3 6D 00 62 6D 00    ..l..m.bm..m.bm.
0247C0:  62 6D 00 62 6D 00 24 6E 00 8D 6E 00 F6 6E 00 1F    bm.bm.$n..n..n..
0247D0:  6F 00 30 6F 00 41 6F 00 A2 6F 00 41 6F 00 03 70    o.0o.Ao..o.Ao..p
0247E0:  00 85 70 80 24 67 00 06 71 00 88 71 00 88 71 00    ..p.$g..q..q..q.
0247F0:  09 72 00 8A 72 00 0B 73 00 8A 72 00 8A 72 00 8C    .r..r..s..r..r..
024800:  7C 66 66 7C 60 60 60 00 7C C6 C6 C6 DA CC 76 00    |ff|```.|.....v.
024810:  7C 66 66 7C 6C 66 66 00 3C 66 60 3C 06 66 3C 00    |ff|lff.<f`<.f<.
024820:  7E 18 18 18 18 18 18 00 66 66 66 66 66 66 3C 00    ~.......ffffff<.
024830:  66 66 66 66 66 3C 18 00 C6 C6 C6 D6 FE EE C6 00    fffff<..........
024840:  C6 6C 38 38 38 6C C6 00 66 66 66 3C 18 18 18 00    .l888l..fff<....
024850:  FE 06 0C 18 30 60 FE 00 3C 30 30 30 30 30 3C 00    ....0`..<00000<.
024860:  00 00 3C 66 60 3E 08 18 3C 0C 0C 0C 0C 0C 3C 00    ..<f`>..<.....<.
024870:  18 24 00 00 00 00 00 00 00 00 00 00 00 00 00 FF    .$..............
024880:  30 18 0C 00 00 00 00 00 00 00 78 0C 7C CC 76 00    0.........x.|.v.
024890:  60 60 7C 66 66 66 7C 00 00 00 3C 66 60 66 3C 00    ``|fff|...<f`f<.
0248A0:  0C 0C 7C CC CC CC 7C 00 00 00 3C 66 7E 60 3C 00    ..|...|...<f~`<.
0248B0:  1C 36 30 78 30 30 30 00 00 00 3E 66 66 3E 06 3C    .60x000...>ff>.<
0248C0:  60 60 6C 76 66 66 66 00 18 00 18 18 18 18 18 00    ``lvfff.........
0248D0:  06 00 0E 06 06 66 66 3C 60 60 66 6C 78 6C 66 00    .....ff<``flxlf.
0248E0:  18 18 18 18 18 18 18 00 00 00 6C FE D6 C6 C6 00    ..........l.....
0248F0:  00 00 3C 66 66 66 66 00 00 00 3C 66 66 66 3C 00    ..<ffff...<fff<.
024900:  00 00 7C 66 66 7C 60 60 00 00 7C CC CC 7C 0C 0C    ..|ff|``..|..|..
024910:  00 00 5C 76 60 60 60 00 00 00 3C 60 3C 06 7C 00    ..\v```...<`<.|.
024920:  30 30 3C 30 30 36 1C 00 00 00 66 66 66 66 3E 00    00<006....ffff>.
024930:  00 00 66 66 66 3C 18 00 00 00 C6 D6 D6 FE 6C 00    ..fff<........l.
024940:  00 00 C6 6C 38 6C C6 00 00 00 66 66 66 3E 06 3C    ...l8l....fff>.<
024950:  00 00 7E 4C 18 32 7E 00 06 08 3C 66 7E 60 3C 00    ..~L.2~...<f~`<.
024960:  30 08 66 66 66 66 3E 00 60 10 3C 66 7E 60 3C 00    0.ffff>.`.<f~`<.
024970:  76 DC 00 00 00 00 00 00 3C 66 60 F8 60 66 FE 00    v.......<f`.`f..
024980:  60 10 78 0C 7C CC 76 00 3C 66 66 66 7E 66 66 00    `.x.|.v.<fff~ff.
024990:  7C 66 66 7C 66 66 7C 00 7C C6 C0 C0 C0 C6 7C 00    |ff|ff|.|.....|.
0249A0:  F8 CC C6 C6 C6 C6 FC 00 FE C6 C0 F0 C0 C6 FE 00    ................
0249B0:  FE C2 C0 F0 C0 C0 C0 00 7C E6 C0 CE C6 E6 7C 00    ........|.....|.
0249C0:  C6 C6 C6 FE C6 C6 C6 00 3C 18 18 18 18 18 3C 00    ........<.....<.
0249D0:  06 06 06 06 C6 C6 7C 00 C6 C6 CC F8 CC C6 C6 00    ......|.........
0249E0:  60 60 60 60 60 66 7E 00 C6 EE FE FE D6 C6 C6 00    `````f~.........
0249F0:  C6 E6 F6 DE CE C6 C6 00 7C C6 C6 C6 C6 C6 7C 00    ........|.....|.
024A00:  73 00 C0 73 00 21 74 00 AA 74 00 21 74 00 33 75    s..s.!t..t.!t.3u
024A10:  00 AD 75 00 BF 75 00 D1 75 00 E3 75 00 09 76 00    ..u..u..u..u..v.
024A20:  23 76 00 6E 76 80 66 67 27 02 F0 00 33 02 00 36    #v.nv.fg'...3..6
024A30:  82 B3 00 B6 00 A7 00 B6 00 33 82 36 82 33 82 25    .........3.6.3.%
024A40:  82 31 82 35 82 B1 00 B5 00 A5 00 B5 00 31 82 35    .1.5.........1.5
024A50:  82 31 82 22 82 2E 82 31 82 AE 00 B1 00 A2 00 B1    .1."...1........
024A60:  00 2E 82 31 82 2E 82 23 82 2F 82 33 82 AF 00 B3    ...1...#./.3....
024A70:  00 A3 00 B3 00 2F 82 33 82 2F 82 FF 52 06 02 50    .£.../.3./..R..P
024A80:  82 52 83 50 83 4E 82 50 86 4E 82 50 83 4E 83 4D    .R.P.N.P.N.P.N.M
024A90:  82 4E 86 4D 82 4E 83 4D 83 49 82 4E 86 4D 82 4E    .N.M.N.M.I.N.M.N
024AA0:  82 4D 82 CE 02 50 83 FF 52 08 F2 00 53 04 02 52    .M...P..R...S..R
024AB0:  84 50 8C 4E 82 50 82 52 86 52 82 53 82 52 82 53    .P.N.P.R.R.S.R.S
024AC0:  82 4E 8F CE 02 50 82 FF 52 08 F2 00 53 04 02 52    .N...P..R...S..R
024AD0:  84 50 8C 4E 82 50 82 52 86 52 82 53 82 52 82 53    .P.N.P.R.R.S.R.S
024AE0:  82 4E 92 FF 52 08 F2 00 53 04 02 52 84 50 8C 4E    .N..R...S..R.P.N
024AF0:  82 50 82 52 86 52 82 53 82 52 82 53 82 4E 8F CE    .P.R.R.S.R.S.N..
024B00:  02 50 82 FF 52 03 02 50 83 4E 82 49 83 4E 83 52    .P..R..P.N.I.N.R
024B10:  82 50 83 4E 83 4D 82 4E 83 4D 83 4E 82 52 83 50    .P.N.M.N.M.N.R.P
024B20:  83 4E 82 4B 83 4E 83 52 82 50 83 4E 83 4B 82 4E    .N.K.N.R.P.N.K.N
024B30:  88 FF 52 03 02 50 83 4E 82 49 83 4E 83 52 82 50    ..R..P.N.I.N.R.P
024B40:  83 4E 83 4D 82 4E 83 4D 83 4E 82 52 83 50 83 4E    .N.M.N.M.N.R.P.N
024B50:  82 4B 83 4E 83 52 82 50 83 4E 83 4B 82 4E 83 4E    .K.N.R.P.N.K.N.N
024B60:  83 50 82 FF 55 0A 02 57 83 D5 02 57 82 55 84 53    .P..U..W...W.U.S
024B70:  82 52 84 4E 86 55 8A 57 83 D5 02 57 82 55 84 53    .R.N.U.W...W.U.S
024B80:  82 52 84 50 86 FF 53 02 02 52 84 4E 84 49 84 4B    .R.P..S..R.N.I.K
024B90:  90 49 82 53 82 52 84 4E 84 49 84 4B 84 55 02 00    .I.S.R.N.I.K.U..
024BA0:  D5 00 55 82 55 83 53 82 D2 00 53 83 FF 2E 03 C2    ..U.U.S...S.....
024BB0:  3C B1 C2 32 AA F1 00 B1 C2 32 36 02 C2 26 2E 03    <..2.....26..&..
024BC0:  C2 3C B1 C2 32 AA F1 00 B1 C2 32 36 02 C2 26 2F    .<..2.....26..&/
024BD0:  03 C2 38 B1 C2 32 A5 F3 00 B1 C2 32 36 02 C2 26    ..8..2.....26..&
024BE0:  2F 03 C2 38 B3 C2 2D A5 F1 00 B3 C2 2D 36 02 C2    /..8..-.....-6..
024BF0:  26 33 03 C2 2D B6 C2 26 A7 F1 00 B6 C2 26 3A 02    &3..-..&.....&:.
024C00:  00 46 41 43 45 20 20 20 20 4D 55 53 00 00 00 00    .FACE    MUS....
024C10:  00 00 02 00 00 00 60 00 BF 16 00 60 00 00 00 00    ......`....`....
024C20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
024C30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
024C40:  BF 16 00 F0 04 41 82 3D 04 B2 03 3A 82 3D 02 B2    .....A.=...:.=..
024C50:  04 3A 82 3D 02 B2 05 3F 86 42 02 B2 06 41 82 3F    .:.=...?.B...A.?
024C60:  02 B2 07 3D 82 3F 04 B2 08 46 02 B2 09 44 04 B2    ...=.?...F...D..
024C70:  0A 42 02 B2 0B 41 02 B2 0C 42 82 41 04 B2 0D 3D    .B...A...B.A...=
024C80:  C3 0B 60 C3 93 60 C3 77 60 66 04 06 03 DD 21 DA    ..`..`.w`f....!.
024C90:  63 FD 21 06 63 11 1C 00 C5 DD 36 06 01 DD 72 09    c.!.c.....6...r.
024CA0:  DD 72 1B DD 36 05 10 FD 6E 00 FD 66 01 7E DD 77    .r..6...n..f.~.w
024CB0:  08 23 4E 23 46 23 DD 75 0C DD 74 0D DD 71 00 DD    .#N#F#.u..t..q..
024CC0:  70 01 DD 19 FD 23 FD 23 C1 10 CD 3E 06 32 BB 60    p....#.#...>.2.`
024CD0:  7A 32 CF 60 3C 32 B6 60 3E 38 32 C0 60 3E FF 32    z2.`<2.`>82.`>.2
024CE0:  02 63 32 03 63 32 04 63 32 05 63 3E 0C 4A CD E4    .c2.c2.c2.c>.J..
024CF0:  62 3E 0D 4A C3 E4 62 3E 07 0E 3F CD E4 62 3E 08    b>.J..b>..?..b>.
024D00:  0E 00 CD E4 62 3E 09 0E 00 CD E4 62 3E 0A 0E 00    ....b>.....b>...
024D10:  C3 E4 62 21 B6 60 35 DD 21 DA 63 01 E8 63 CD 49    ..b!.`5.!.c..c.I
024D20:  61 DD 21 F6 63 01 04 64 CD 49 61 DD 21 12 64 01    a.!.c..d.Ia.!.d.
024D30:  20 64 CD 49 61 3E 00 B7 20 05 3E 00 32 B6 60 3E     d.Ia>.. .>.2.`>
024D40:  00 21 03 63 BE 28 07 77 4F 3E 07 CD E4 62 3E 00    .!.c.(.wO>...b>.
024D50:  21 02 63 BE 28 07 77 4F 3E 06 CD E4 62 3E 00 21    !.c.(.wO>...b>.!
024D60:  04 63 BE 28 07 77 4F 3E 0B CD E4 62 3E 00 21 05    .c.(.wO>...b>.!.
024D70:  63 BE C8 77 4F 3E 0D C3 E4 62 23 46 DD 70 06 23    c..wO>...b#F.p.#
024D80:  DD 75 00 DD 74 01 C3 FA 61 23 7E DD 77 06 23 DD    .u..t...a#~.w.#.
024D90:  75 00 DD 74 01 AF DD 77 17 DD 77 15 4F DD 7E 04    u..t...w..w.O.~.
024DA0:  C3 E4 62 DD 36 0A 00 DD 6E 0C DD 66 0D 7E FE 80    ..b.6...n..f.~..
024DB0:  20 06 23 5E 23 56 EB 7E 23 5E 23 56 23 DD 75 0C     .#^#V.~#^#V#.u.
024DC0:  DD 74 0D DD 77 08 EB 18 13 3A B6 60 B7 C2 FA 61    .t..w....:.`...a
024DD0:  DD 35 06 C2 FA 61 DD 6E 00 DD 66 01 7E B7 28 9A    .5...a.n..f.~.(.
024DE0:  FE FE 28 A5 FE FF 28 BB 16 00 E6 7F D6 0A DD 86    ..(...(.........
024DF0:  08 DD 77 07 87 5F E5 21 0C 63 19 7E DD 77 18 23    ..w.._.!.c.~.w.#
024E00:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
024E10:  1F 00 01 00 02 09 51 E5 1F 00 C1 02 00 00 00 02    ......Q.........
024E20:  1F 00 C6 02 00 00 00 02 1F 00 C2 02 00 00 00 02    ................
024E30:  1F 00 C7 02 00 00 00 02 1F 00 C3 02 00 00 00 02    ................
024E40:  1F 00 C8 02 00 00 00 02 1F 00 C4 02 00 00 00 02    ................
024E50:  1F 00 C9 02 00 00 00 02 1F 00 C5 02 00 00 00 02    ................
024E60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
024E70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
024E80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
024E90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
024EA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
024EB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
024EC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
024ED0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
024EE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
024EF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
024F00:  C2 1E 33 03 C2 2D B6 C2 26 A7 F1 00 B6 C2 26 3A    ..3..-..&.....&:
024F10:  02 C2 1E 36 03 C2 26 B8 C2 22 A3 F1 00 B8 C2 22    ...6..&.."£...."
024F20:  3D 02 C2 19 36 03 C2 26 B8 C2 22 A3 F1 00 B8 C2    =...6..&.."£....
024F30:  22 3D 02 C2 19 FF AA F1 00 AA 02 B6 02 AA 01 AA    "=..............
024F40:  03 AA 02 B6 02 AA 02 AA 01 AA 02 B6 02 AA 02 AA    ................
024F50:  03 AA 02 B6 02 AA 02 A5 01 A5 02 B1 02 A5 01 A5    ................
024F60:  03 A5 02 B1 02 A5 02 A5 01 A5 02 B1 02 A5 02 A5    ................
024F70:  03 A5 02 B1 02 A5 02 A7 01 A7 02 B3 02 A7 02 A7    ................
024F80:  03 A7 02 B3 02 A7 02 A7 01 A7 02 B3 02 A7 02 A7    ................
024F90:  03 A7 02 B3 02 A7 02 A3 01 A3 02 AF 02 A3 01 A3    .......£.£...£.£
024FA0:  03 A3 02 AF 02 A3 02 A3 01 A3 02 AF 02 A3 02 A3    .£...£.£.£...£.£
024FB0:  03 A3 02 AF 02 A3 02 FF AA 01 AA 02 B6 02 AA 01    .£...£..........
024FC0:  AA 03 AA 02 B6 02 AA 02 AA 01 AA 02 B6 02 AA 02    ................
024FD0:  AA 03 AA 02 B6 02 AA 02 A5 01 A5 02 B1 02 A5 01    ................
024FE0:  A5 03 A5 02 B1 02 A5 02 A5 01 A5 02 B1 02 A5 02    ................
024FF0:  A5 03 A5 02 B1 02 A5 02 A7 01 A7 02 B3 02 A7 02    ................
025000:  A7 03 A7 02 B3 02 A7 02 A7 01 A7 02 B3 02 A7 02    ................
025010:  A7 03 A7 02 B3 02 A7 02 A3 01 A3 02 AF 02 A3 01    ........£.£...£.
025020:  A3 03 A3 02 AF 02 A3 02 A3 01 A3 02 AF 02 A3 02    £.£...£.£.£...£.
025030:  A3 03 A3 02 AF 02 A3 02 FF A7 01 A7 02 B3 02 A7    £.£...£.........
025040:  02 A7 01 A7 02 B3 02 A7 02 A7 01 A7 02 B3 02 A7    ................
025050:  02 A7 03 A7 02 B3 02 A7 02 A5 01 A5 02 B1 02 A5    ................
025060:  01 A5 03 A5 02 B1 02 A5 02 A5 01 A5 02 B1 02 A5    ................
025070:  02 A5 03 A5 02 B1 02 A5 02 A3 01 A3 02 AF 02 A3    .........£.£...£
025080:  02 A3 03 A3 02 AF 02 A3 02 A3 01 A3 02 AF 02 A3    .£.£...£.£.£...£
025090:  02 A3 01 A3 02 AF 02 A3 02 AA 01 AA 02 B6 02 AA    .£.£...£........
0250A0:  02 AA 03 AA 02 B6 02 AA 02 A9 01 A9 02 B5 02 A9    ................
0250B0:  02 A9 03 A9 02 B5 02 A9 02 FF A7 01 A7 02 B3 02    ................
0250C0:  A7 02 A7 01 A7 02 B3 02 A7 02 A7 01 A7 02 B3 02    ................
0250D0:  A7 02 A7 03 A7 02 B3 02 A7 02 A5 01 A5 02 B1 02    ................
0250E0:  A5 01 A5 03 A5 02 B1 02 A5 02 A5 01 A5 02 B1 02    ................
0250F0:  A5 02 A5 03 A5 02 B1 02 A5 02 A3 01 A3 02 AF 02    ..........£.£...
025100:  02 A3 02 A3 03 A3 02 AF 02 A3 02 FF 00 01 52 03    .£.£.£...£....R.
025110:  02 50 83 4E 82 49 83 4E 83 52 82 50 83 4E 83 4D    .P.N.I.N.R.P.N.M
025120:  82 4E 83 4D 83 4E 82 52 83 50 83 4E 82 4B 83 4E    .N.M.N.R.P.N.K.N
025130:  83 52 82 50 83 4E 83 4B 82 4E 83 4E 83 D0 02 FF    .R.P.N.K.N.N....
025140:  2E 03 C2 3C 31 03 C2 32 36 02 C2 26 2E 03 C2 3C    ...<1..26..&...<
025150:  31 03 C2 32 36 02 C2 26 2F 03 C2 38 31 03 C2 32    1..26..&/..81..2
025160:  36 02 C2 26 2F 03 C2 38 33 03 C2 2D 36 02 C2 26    6..&/..83..-6..&
025170:  33 03 C2 2D 36 03 C2 26 3A 02 C2 1E 33 03 C2 2D    3..-6..&:...3..-
025180:  36 03 C2 26 3A 02 C2 1E 36 03 C2 26 38 03 C2 22    6..&:...6..&8.."
025190:  3D 02 C2 19 36 03 C2 26 38 03 C2 22 3D 02 C2 19    =...6..&8.."=...
0251A0:  FF 2E 03 C2 3C B1 C2 32 AA F1 00 B1 C2 32 36 02    ....<..2.....26.
0251B0:  C2 26 2E 03 C2 3C B1 C2 32 AA F1 00 B1 C2 32 36    .&...<..2.....26
0251C0:  02 C2 26 2F 03 C2 38 B1 C2 32 A5 F3 00 B1 C2 32    ..&/..8..2.....2
0251D0:  36 02 C2 26 2F 03 C2 38 B3 C2 2D A5 F1 00 B3 C2    6..&/..8..-.....
0251E0:  2D 36 02 C2 26 33 03 C2 2D B6 C2 26 A7 F1 00 B6    -6..&3..-..&....
0251F0:  C2 26 3A 02 C2 1E 33 03 C2 2D B6 C2 26 A7 F1 00    .&:...3..-..&...
025200:  B6 C2 26 3A 02 C2 1E 36 03 C2 26 B8 C2 22 A3 F1    ..&:...6..&.."£.
025210:  00 B8 C2 22 3D 02 C2 19 36 03 C2 26 B8 C2 22 A3    ..."=...6..&.."£
025220:  F1 00 B8 C2 22 3D 02 C2 19 FF 2E 03 C2 3C B1 C2    ...."=.......<..
025230:  32 AA F1 00 B1 C2 32 36 02 C2 26 2E 03 C2 3C B1    2.....26..&...<.
025240:  C2 32 AA F1 00 B1 C2 32 36 02 C2 26 2F 03 C2 38    .2.....26..&/..8
025250:  B1 C2 32 A5 F3 00 B1 C2 32 36 02 C2 26 2F 03 C2    ..2.....26..&/..
025260:  38 B3 C2 2D A5 F1 00 B3 C2 2D 36 02 C2 26 33 03    8..-.....-6..&3.
025270:  C2 2D B6 C2 26 A7 F1 00 B6 C2 26 3A 02 C2 1E 33    .-..&.....&:...3
025280:  03 C2 2D B6 C2 26 A7 F1 00 B6 C2 26 3A 02 C2 1E    ..-..&.....&:...
025290:  36 03 C2 26 B8 C2 22 A3 F1 00 B8 C2 22 3D 02 C2    6..&.."£...."=..
0252A0:  19 36 03 C2 26 B8 C2 22 A3 F1 00 B8 C2 22 3D 02    .6..&.."£...."=.
0252B0:  C2 19 FF CE F3 02 4E 02 B0 01 CE 00 4E 82 CE 00    ......N.....N...
0252C0:  CE 00 CE 03 CE B0 01 4E 02 00 CE 00 4E 82 CE 00    .......N....N...
0252D0:  C9 F3 02 49 02 B0 02 C9 00 49 82 C9 00 C9 00 C9    ...I.....I......
0252E0:  03 C9 B0 02 49 02 00 C9 00 49 82 C9 00 CB F3 01    ....I....I......
0252F0:  4B 02 B0 03 CB 00 4B 82 CB 00 CB 00 CB 03 CB B0    K.....K.........
025300:  A3 02 A3 03 A3 02 AF 02 A3 02 A3 01 A3 02 AF 02    £.£.£...£.£.£...
025310:  A3 02 A3 01 A3 02 AF 02 A3 02 AA 01 AA 02 B6 02    £.£.£...£.......
025320:  AA 02 AA 03 AA 02 B6 02 AA 02 A9 01 A9 02 B5 02    ................
025330:  A9 02 A9 03 A9 02 B5 02 A9 02 FF 42 02 02 41 02    ...........B..A.
025340:  02 3F 02 02 3D 02 02 3F 04 02 41 02 02 3D 04 02    .?..=..?..A..=..
025350:  3A 02 02 3D 02 02 3A 02 02 3D 02 02 3F 06 02 42    :..=..:..=..?..B
025360:  02 02 41 02 02 3F 02 02 3D 02 02 3F 04 02 46 02    ..A..?..=..?..F.
025370:  02 44 04 02 42 02 02 41 02 02 42 02 02 41 04 02    .D..B..A..B..A..
025380:  3D 04 02 FF 42 02 B2 00 41 02 B2 01 3F 82 3D 82    =...B...A...?.=.
025390:  3F 04 B2 02 41 82 3D 04 B2 03 3A 82 3D 02 B2 04    ?...A.=...:.=...
0253A0:  3A 82 3D 02 B2 05 3F 86 42 02 B2 06 41 82 3F 02    :.=...?.B...A.?.
0253B0:  B2 07 3D 82 3F 04 B2 08 46 02 B2 09 44 04 B2 0A    ..=.?...F...D...
0253C0:  42 02 B2 0B 41 02 B2 0C 42 82 41 04 B2 0D 3D 04    B...A...B.A...=.
0253D0:  B2 0E FF A7 B2 0F 26 3F F2 00 FF 27 02 F0 00 33    ......&?...'...3
0253E0:  02 00 36 82 B3 00 B6 00 A7 00 B6 00 33 82 36 82    ..6.........3.6.
0253F0:  33 82 25 82 31 82 35 82 B1 00 B5 00 A5 00 B5 00    3.%.1.5.........
025400:  31 82 35 82 31 82 22 82 2E 82 31 82 AE 00 B1 00    1.5.1."...1.....
025410:  A2 00 B1 00 2E 82 31 82 2E 82 23 82 2F 82 33 82    ......1...#./.3.
025420:  AF 00 B3 00 A3 00 B3 00 2F 82 33 82 2F 82 FF 2A    ....£.../.3./..*
025430:  02 00 36 82 3A 82 B6 00 BA 00 AA 00 BA 00 36 82    ..6.:.........6.
025440:  3A 82 36 82 25 82 31 82 35 82 B1 00 B5 00 A5 00    :.6.%.1.5.......
025450:  B5 00 31 82 35 82 31 82 27 82 33 82 36 82 B3 00    ..1.5.1.'.3.6...
025460:  B6 00 A7 00 B6 00 33 82 36 82 33 82 23 82 2F 82    ......3.6.3.#./.
025470:  33 82 AF 00 B3 00 A3 00 B3 00 2F 82 33 82 2F 82    3.....£.../.3./.
025480:  FF CB F0 01 4B 02 00 CB 00 4B 82 CB 00 4B 82 CB    ....K....K...K..
025490:  00 4B 82 CB 00 4B 82 CB 00 C9 F0 02 49 02 00 C9    .K...K......I...
0254A0:  00 49 82 C9 00 49 82 C9 00 49 82 C9 00 49 82 C9    .I...I...I...I..
0254B0:  00 C6 F0 01 46 02 00 C6 00 46 82 C6 00 46 82 C6    ....F....F...F..
0254C0:  00 46 82 C6 00 46 82 C6 00 C7 F0 02 47 02 00 C7    .F...F......G...
0254D0:  00 47 82 C7 00 47 82 C7 00 47 82 C7 00 47 82 C7    .G...G...G...G..
0254E0:  00 FF CE F0 02 4E 02 00 CE 00 4E 82 CE 00 4E 82    .....N....N...N.
0254F0:  CE 00 4E 82 CE 00 4E 82 CE 00 C9 F0 02 49 02 00    ..N...N......I..
025500:  03 4B 02 00 CB 00 4B 82 CB 00 C7 F3 02 47 02 B0    .K....K......G..
025510:  04 C7 B0 04 47 82 C7 B0 04 C7 B0 04 C7 03 C7 B0    ....G...........
025520:  04 47 02 B0 05 C7 B0 05 47 82 C7 00 FF 4E 10 F2    .G......G....N..
025530:  00 50 0C B2 00 52 04 02 4E 90 4B 8C 49 84 FF 4E    .P...R..N.K.I..N
025540:  10 F2 00 50 06 02 55 84 53 82 52 84 52 90 4E 90    ...P..U.S.R.R.N.
025550:  FF 4E 10 02 4E 86 4D 86 49 84 4B 90 49 86 47 86    .N..N.M.I.K.I.G.
025560:  46 84 FF 4E 10 02 4E 86 4D 86 49 84 4B 8E 4E 82    F..N..N.M.I.K.N.
025570:  D2 02 D0 02 4E 82 D2 02 D0 02 4E 82 D5 02 D3 02    ....N.....N.....
025580:  52 82 D5 02 D3 02 52 82 FF 4E 02 02 4D 82 4B 82    R.....R..N..M.K.
025590:  49 82 4B 84 4D 82 49 8C 4B 86 47 8C 49 82 46 8E    I.K.M.I.K.G.I.F.
0255A0:  49 84 FF 00 01 42 02 02 41 02 02 3F 02 02 3D 02    I....B..A..?..=.
0255B0:  02 3F 04 02 41 02 02 3D 04 02 3A 02 02 3D 02 02    .?..A..=..:..=..
0255C0:  3A 02 02 3D 02 02 3F 06 02 42 02 02 41 02 02 3F    :..=..?..B..A..?
0255D0:  02 02 3D 02 02 3F 04 02 46 02 02 44 04 02 42 02    ..=..?..F..D..B.
0255E0:  02 41 02 02 42 02 02 41 04 02 3D 03 02 FF 00 01    .A..B..A..=.....
0255F0:  42 02 B2 00 41 02 B2 01 3F 82 3D 82 3F 04 B2 02    B...A...?.=.?...
025600:  41 82 3D 04 B2 03 3A 82 3D 02 B2 04 3A 82 3D 02    A.=...:.=...:.=.
025610:  B2 05 3F 86 42 02 B2 06 41 82 3F 02 B2 07 3D 82    ..?.B...A.?...=.
025620:  3F 04 B2 08 46 02 B2 09 44 04 B2 0A 42 02 B2 0B    ?...F...D...B...
025630:  41 02 B2 0C 42 82 41 04 B2 0D 3D 03 B2 0E FF 1A    A...B.A...=.....
025640:  80 38 00 50 05 00 00 46 41 43 45 20 20 20 20 24    .8.P...FACE    $
025650:  24 24 FF 00 FF 00 00 02 00 00 80 40 00 80 38 00    $$.........@..8.
025660:  00 00 00 00 00 00 00 53 54 00 00 00 00 00 00 00    .......ST.......
025670:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
025680:  03 C2 2D B6 C2 26 A7 F1 00 B6 C2 26 3A 02 C2 1E    ..-..&.....&:...
025690:  36 03 C2 26 B8 C2 22 A3 F1 00 B8 C2 22 3D 02 C2    6..&.."£...."=..
0256A0:  19 36 03 C2 26 B8 C2 22 A3 F1 00 B8 C2 22 3D 02    .6..&.."£...."=.
0256B0:  C2 19 FF CE F3 02 4E 02 B0 01 CE 00 4E 82 CE 00    ......N.....N...
0256C0:  CE 00 CE 03 CE B0 01 4E 02 00 CE 00 4E 82 CE 00    .......N....N...
0256D0:  C9 F3 02 49 02 B0 02 C9 00 49 82 C9 00 C9 00 C9    ...I.....I......
0256E0:  03 C9 B0 02 49 02 00 C9 00 49 82 C9 00 CB F3 01    ....I....I......
0256F0:  4B 02 B0 03 CB 00 4B 82 CB 00 CB 00 CB 03 CB B0    K.....K.........
025700:  C9 00 49 82 C9 00 49 82 C9 00 49 82 C9 00 49 82    ..I...I...I...I.
025710:  C9 00 CB F0 01 4B 02 00 CB 00 4B 82 CB 00 4B 82    .....K....K...K.
025720:  CB 00 4B 82 CB 00 4B 82 CB 00 C7 F0 02 47 02 00    ..K...K......G..
025730:  C7 00 47 82 C7 00 47 82 C7 00 47 82 C7 00 47 82    ..G...G...G...G.
025740:  C7 00 FF CE F0 02 4E 02 00 CE 00 4E 82 CE 00 4E    ......N....N...N
025750:  82 CE 00 4E 82 CE 00 4E 82 CE 00 C9 F0 02 49 02    ...N...N......I.
025760:  00 C9 00 49 82 C9 00 49 82 C9 00 49 82 C9 00 49    ...I...I...I...I
025770:  82 C9 00 CB F0 01 4B 02 00 CB 00 4B 82 CB 00 4B    ......K....K...K
025780:  82 CB 00 4B 82 CB 00 4B 82 CB 00 C7 F0 02 47 02    ...K...K......G.
025790:  00 C7 00 47 82 C7 00 47 82 C7 00 47 82 C7 00 47    ...G...G...G...G
0257A0:  82 C7 00 FF CE F3 02 4E 02 00 CE 00 4E 82 CE 00    .......N....N...
0257B0:  CE 00 CE 03 CE 00 4E 82 CE 00 4E 82 CE 00 C9 F3    ......N...N.....
0257C0:  02 49 02 00 C9 00 49 82 C9 00 C9 00 C9 03 C9 00    .I....I.........
0257D0:  49 82 C9 00 49 82 C9 00 CB F3 01 4B 02 00 CB 00    I...I......K....
0257E0:  4B 82 CB 00 CB 00 CB 03 CB 00 4B 82 CB 00 4B 82    K.........K...K.
0257F0:  CB 00 C7 F3 02 47 02 00 C7 00 47 82 C7 00 C7 00    .....G....G.....
025800:  C7 03 C7 00 47 82 C7 00 47 82 C7 00 FF CE F3 02    ....G...G.......
025810:  4E 02 00 CE 00 4E 82 CE 00 CE 00 CE 03 CE 00 4E    N....N.........N
025820:  82 CE 00 4E 82 CE 00 C9 F3 02 49 02 00 C9 00 49    ...N......I....I
025830:  82 C9 00 C9 00 C9 03 C9 00 49 82 C9 00 49 82 C9    .........I...I..
025840:  00 CB F3 01 4B 02 00 CB 00 4B 82 CB 00 CB 00 CB    ....K....K......
025850:  03 CB 00 4B 82 CB 00 4B 82 CB 00 C7 F3 02 47 02    ...K...K......G.
025860:  00 C7 00 47 82 C7 00 C7 00 C7 03 C7 00 47 82 C7    ...G.........G..
025870:  00 47 82 C7 00 FF 55 0E F2 00 52 02 02 50 0C B2    .G....U...R..P..
025880:  00 CE 02 50 83 52 10 B2 00 C9 02 4B 02 B2 00 4B    ...P.R.....K...K
025890:  03 02 C9 02 4E 82 4E 82 C9 02 4E 82 50 82 FF 36    ....N.N...N.P..6
0258A0:  10 C2 4C 31 10 C2 32 33 10 C2 2D 2F 10 C2 38 FF    ..L1..23..-/..8.
0258B0:  36 10 C2 4C 31 10 C2 32 33 10 C2 2D 2F 10 C2 38    6..L1..23..-/..8
0258C0:  FF 42 02 C2 13 41 02 C2 14 3F 02 C2 16 3D 02 C2    .B...A...?...=..
0258D0:  19 3F 04 C2 16 41 02 C2 14 3D 04 C2 19 3A 02 C2    .?...A...=...:..
0258E0:  1E 3D 02 C2 19 3A 02 C2 1E 3D 02 C2 19 3F 06 C2    .=...:...=...?..
0258F0:  16 42 02 C2 13 41 02 C2 14 3F 02 C2 16 3D 02 C2    .B...A...?...=..
025900:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
025910:  20 20 20 20 20 20 20 20 20 2A 20 47 68 6F 75 6C             * Ghoul
025920:  27 73 20 57 72 69 74 65 72 20 31 2E 30 20 2A 0D    's Writer 1.0 *.
025930:  0A 0D 0A 20 20 20 20 20 20 20 20 20 20 20 20 20    ...             
025940:  20 20 20 20 20 20 20 20 20 54 6F 6D 20 65 74 20             Tom et 
025950:  4A 65 72 72 79 20 6F 66 20 47 50 41 20 28 63 29    Jerry of GPA (c)
025960:  20 31 39 39 34 0D 0A 0D 0A 20 20 20 20 20 20 20     1994....       
025970:  20 20 20 20 20 20 20 20 20 20 20 20 2A 20 43 65                * Ce
025980:  20 70 72 6F 67 72 61 6D 6D 65 20 65 73 74 20 75     programme est u
025990:  6E 20 73 68 61 72 65 77 61 72 65 20 21 21 20 2A    n shareware !! *
0259A0:  20 20 20 20 0D 0A 0D 0A 0D 0A 49 20 50 72 65 73        ......I Pres
0259B0:  65 6E 74 61 74 69 6F 6E 20 0D 0A 0D 0A 47 68 6F    entation ....Gho
0259C0:  75 6C 27 73 20 57 72 69 74 65 72 20 65 73 74 20    ul's Writer est 
0259D0:  20 75 6E 20 65 6E 73 65 6D 62 6C 65 20 64 65 20     un ensemble de 
0259E0:  20 70 72 6F 67 72 61 6D 6D 65 73 20 20 71 75 69     programmes  qui
0259F0:  20 70 65 72 6D 65 74 74 65 6E 74 20 64 65 20 67     permettent de g
025A00:  65 6E 65 6E 65 72 20 20 53 41 4E 53 0D 0A 50 52    enener  SANS..PR
025A10:  4F 47 52 41 4D 4D 41 54 49 4F 4E 20 64 65 73 20    OGRAMMATION des 
025A20:  70 72 65 73 65 6E 74 61 74 69 6F 6E 73 20 20 73    presentations  s
025A30:  6F 75 73 20 66 6F 72 6D 65 20 20 64 65 20 66 69    ous forme  de fi
025A40:  63 68 69 65 72 73 20 65 78 65 63 75 74 61 62 6C    chiers executabl
025A50:  65 73 2E 20 56 6F 75 73 20 70 6F 75 2D 0D 0A 76    es. Vous pou-..v
025A60:  65 7A 20 67 72 61 63 65 20 61 20 20 47 2E 57 2E    ez grace a  G.W.
025A70:  20 65 6E 76 6F 79 65 72 20 64 65 73 20 27 6C 65     envoyer des 'le
025A80:  74 74 72 65 73 20 69 6E 66 6F 72 6D 61 74 69 71    ttres informatiq
025A90:  75 65 73 27 20 20 61 20 76 6F 73 20 61 6D 69 73    ues'  a vos amis
025AA0:  2C 20 20 72 65 64 69 67 65 72 20 64 65 73 0D 0A    ,  rediger des..
025AB0:  61 72 74 69 63 6C 65 73 20 20 70 6F 75 72 20 64    articles  pour d
025AC0:  65 73 20 66 61 6E 7A 69 6E 65 73 2C 20 65 74 63    es fanzines, etc
025AD0:  2E 2E 2E 20 20 20 50 61 72 20 72 61 70 70 6F 72    ...   Par rappor
025AE0:  74 20 61 75 78 20 70 72 6F 67 72 61 6D 6D 65 73    t aux programmes
025AF0:  20 65 78 69 73 74 61 6E 74 73 20 70 6C 75 73 0D     existants plus.
025B00:  19 3F 04 C2 16 46 02 C2 1E 44 04 C2 11 42 02 C2    .?...F...D...B..
025B10:  13 41 02 C2 14 42 02 C2 13 41 04 C2 14 3D 04 C2    .A...B...A...=..
025B20:  19 FF 42 02 C2 13 41 02 C2 14 3F 02 C2 16 3D 02    ..B...A...?...=.
025B30:  C2 19 3F 04 C2 16 41 02 C2 14 3D 04 C2 19 3A 02    ..?...A...=...:.
025B40:  C2 1E 3D 02 C2 19 3A 02 C2 1E 3D 02 C2 19 3F 06    ..=...:...=...?.
025B50:  C2 16 42 02 C2 13 41 02 C2 14 3F 02 C2 16 3D 02    ..B...A...?...=.
025B60:  C2 19 3F 04 C2 16 46 02 C2 1E 44 04 C2 11 42 02    ..?...F...D...B.
025B70:  C2 13 41 02 C2 14 42 02 C2 13 41 04 C2 14 3D 04    ..A...B...A...=.
025B80:  C2 19 FF A7 F1 00 A7 02 B3 02 A7 02 A7 01 A7 02    ................
025B90:  B3 02 A7 02 A7 01 A7 02 B3 02 A7 02 A7 03 A7 02    ................
025BA0:  B3 02 A7 02 A5 01 A5 02 B1 02 A5 01 A5 03 A5 02    ................
025BB0:  B1 02 A5 02 A5 01 A5 02 B1 02 A5 02 A5 03 A5 02    ................
025BC0:  B1 02 A5 02 A3 01 A3 02 AF 02 A3 02 A3 03 A3 02    ....£.£...£.£.£.
025BD0:  AF 02 A3 02 A3 01 A3 02 AF 02 A3 02 A3 01 A3 02    ..£.£.£...£.£.£.
025BE0:  AF 02 A3 02 AA 01 AA 02 B6 02 AA 02 AA 03 AA 02    ..£.............
025BF0:  B6 02 AA 02 A9 01 A9 02 B5 02 A9 02 A9 03 A9 02    ................
025C00:  B5 02 A9 02 FF A7 01 A7 02 B3 02 A7 02 A7 01 A7    ................
025C10:  02 B3 02 A7 02 A7 01 A7 02 B3 02 A7 02 A7 03 A7    ................
025C20:  02 B3 02 A7 02 A5 01 A5 02 B1 02 A5 01 A5 03 A5    ................
025C30:  02 B1 02 A5 02 A5 01 A5 02 B1 02 A5 02 A5 03 A5    ................
025C40:  02 B1 02 A5 02 A3 01 A3 02 AF 02 A3 02 A3 03 A3    .....£.£...£.£.£
025C50:  02 AF 02 A3 02 A3 01 A3 02 AF 02 A3 02 A3 01 A3    ...£.£.£...£.£.£
025C60:  02 AF 02 A3 02 AA 01 AA 02 B6 02 AA 02 AA 03 AA    ...£............
025C70:  02 B6 02 AA 02 A9 01 A9 02 B5 02 A9 02 A9 03 A9    ................
025C80:  02 B5 02 A9 02 FF A7 F1 00 A7 02 B3 02 A7 01 A7    ................
025C90:  03 A7 02 B3 02 A7 02 A7 01 A7 02 B3 02 A7 02 A7    ................
025CA0:  03 A7 02 B3 02 A7 02 A5 01 A5 02 B1 02 A5 01 A5    ................
025CB0:  03 A5 02 B1 02 A5 02 A5 01 A5 02 B1 02 A5 02 A5    ................
025CC0:  03 A5 02 B1 02 A5 02 A2 01 A2 02 AE 02 A2 02 A2    ................
025CD0:  03 A2 02 AE 02 A2 02 A2 01 A2 02 AE 02 A2 02 A2    ................
025CE0:  03 A2 02 AE 02 A2 02 A3 01 A3 02 AF 02 A3 01 A3    .......£.£...£.£
025CF0:  03 A3 02 AF 02 A3 02 A3 01 A3 02 AF 02 A3 02 A3    .£...£.£.£...£.£
025D00:  0A 6F 75 20 6D 6F 69 6E 73 20 73 69 6D 69 6C 61    .ou moins simila
025D10:  69 72 65 73 20 28 47 68 6F 73 74 20 77 72 69 74    ires (Ghost writ
025D20:  65 72 20 64 65 20 4D 54 49 2C 20 20 4B 61 6E 67    er de MTI,  Kang
025D30:  61 72 6F 6F 27 73 20 6C 65 74 74 65 72 20 63 72    aroo's letter cr
025D40:  65 61 74 6F 72 29 2C 20 47 2E 57 20 70 72 6F 2D    eator), G.W pro-
025D50:  0D 0A 70 6F 73 65 20 64 65 73 20 20 6F 70 74 69    ..pose des  opti
025D60:  6F 6E 73 20 71 75 69 20 70 65 72 6D 65 74 74 65    ons qui permette
025D70:  6E 74 20 20 64 65 20 70 65 72 73 6F 6E 6E 61 6C    nt  de personnal
025D80:  69 73 65 72 20 70 72 65 73 71 75 65 20 20 61 20    iser presque  a 
025D90:  6C 27 69 6E 66 69 6E 69 20 75 6E 65 20 70 72 65    l'infini une pre
025DA0:  2D 0D 0A 73 65 6E 74 61 74 69 6F 6E 20 65 6E 20    -..sentation en 
025DB0:  69 6E 74 65 67 72 61 6E 74 20 76 6F 73 20 70 72    integrant vos pr
025DC0:  6F 70 72 65 73 20 67 72 61 70 68 69 73 6D 65 73    opres graphismes
025DD0:  2C 20 6D 75 73 69 71 75 65 73 2C 20 65 66 66 65    , musiques, effe
025DE0:  74 73 20 64 27 61 6E 69 6D 61 74 69 6F 6E 20 21    ts d'animation !
025DF0:  20 0D 0A 0D 0A 43 68 61 71 75 65 20 66 69 63 68     ....Chaque fich
025E00:  69 65 72 20 20 65 78 65 63 75 74 61 62 6C 65 20    ier  executable 
025E10:  63 72 65 65 20 61 76 65 63 20 47 2E 57 2E 20 20    cree avec G.W.  
025E20:  65 73 74 20 75 6E 20 61 73 73 65 6D 62 6C 61 67    est un assemblag
025E30:  65 20 20 64 65 20 70 6C 75 73 69 65 75 72 73 20    e  de plusieurs 
025E40:  20 66 69 2D 0D 0A 63 68 69 65 72 73 20 64 65 20     fi-..chiers de 
025E50:  64 6F 6E 6E 65 65 73 20 3A 0D 0A 0D 0A 20 20 20    donnees :....   
025E60:  20 20 20 20 20 2A 20 55 6E 65 20 6D 75 73 69 71         * Une musiq
025E70:  75 65 20 61 75 20 66 6F 72 6D 61 74 20 53 6F 75    ue au format Sou
025E80:  6E 64 74 72 61 6B 6B 65 72 0D 0A 20 20 20 20 20    ndtrakker..     
025E90:  20 20 20 2A 20 55 6E 65 20 66 6F 6E 74 65 20 64       * Une fonte d
025EA0:  65 20 63 61 72 61 63 74 65 72 65 73 20 61 75 20    e caracteres au 
025EB0:  66 6F 72 6D 61 74 20 54 41 4F 43 50 20 41 72 74    format TAOCP Art
025EC0:  20 53 74 75 64 69 6F 0D 0A 20 20 20 20 20 20 20     Studio..       
025ED0:  20 2A 20 55 6E 20 74 65 78 74 65 0D 0A 20 20 20     * Un texte..   
025EE0:  20 20 20 20 20 2A 20 75 6E 20 6C 6F 67 6F 0D 0A         * un logo..
025EF0:  20 20 20 20 20 20 20 20 2A 20 75 6E 65 20 74 61            * une ta
025F00:  03 A3 02 AF 02 A3 02 FF A7 01 A7 02 B3 02 A7 01    .£...£..........
025F10:  A7 03 A7 02 B3 02 A7 02 A7 01 A7 02 B3 02 A7 02    ................
025F20:  A7 03 A7 02 B3 02 A7 02 A5 01 A5 02 B1 02 A5 01    ................
025F30:  A5 03 A5 02 B1 02 A5 02 A5 01 A5 02 B1 02 A5 02    ................
025F40:  A5 03 A5 02 B1 02 A5 02 A2 01 A2 02 AE 02 A2 02    ................
025F50:  A2 03 A2 02 AE 02 A2 02 A2 01 A2 02 AE 02 A2 02    ................
025F60:  A2 03 A2 02 AE 02 A2 02 A3 01 A3 02 AF 02 A3 01    ........£.£...£.
025F70:  A3 03 A3 02 AF 02 A3 02 A3 01 A3 02 AF 02 A3 02    £.£...£.£.£...£.
025F80:  A3 03 A3 02 AF 02 A3 02 FF AA 01 AA 02 B6 02 AA    £.£...£.........
025F90:  01 AA 03 AA 02 B6 02 AA 02 AA 01 AA 02 B6 02 AA    ................
025FA0:  02 AA 03 AA 02 B6 02 AA 02 A5 01 A5 02 B1 02 A5    ................
025FB0:  01 A5 03 A5 02 B1 02 A5 02 A5 01 A5 02 B1 02 A5    ................
025FC0:  02 A5 03 A5 02 B1 02 A5 02 A7 01 A7 02 B3 02 A7    ................
025FD0:  02 A7 03 A7 02 B3 02 A7 02 A7 01 A7 02 B3 02 A7    ................
025FE0:  02 A7 03 A7 02 B3 02 A7 02 A3 01 A3 02 AF 02 A3    .........£.£...£
025FF0:  01 A3 03 A3 02 AF 02 A3 02 A3 01 A3 02 AF 02 A3    .£.£...£.£.£...£
026000:  02 A3 03 A3 02 AF 02 A3 02 FF AA 01 AA 02 B6 02    .£.£...£........
026010:  AA 01 AA 03 AA 02 B6 02 AA 02 AA 01 AA 02 B6 02    ................
026020:  AA 02 AA 03 AA 02 B6 02 AA 02 A5 01 A5 02 B1 02    ................
026030:  A5 01 A5 03 A5 02 B1 02 A5 02 A5 01 A5 02 B1 02    ................
026040:  A5 02 A5 03 A5 02 B1 02 A5 02 A7 01 A7 02 B3 02    ................
026050:  A7 02 A7 03 A7 02 B3 02 A7 02 A7 01 A7 02 B3 02    ................
026060:  A7 02 A7 03 A7 02 B3 02 A7 02 A3 01 A3 02 AF 02    ..........£.£...
026070:  A3 01 A3 03 A3 02 AF 02 A3 02 A3 01 A3 02 AF 02    £.£.£...£.£.£...
026080:  A3 02 A3 03 A3 02 AF 02 A3 02 FF A7 01 A7 02 B3    £.£.£...£.......
026090:  02 A7 01 A7 03 A7 02 B3 02 A7 02 A7 01 A7 02 B3    ................
0260A0:  02 A7 02 A7 03 A7 02 B3 02 A7 02 A5 01 A5 02 B1    ................
0260B0:  02 A5 01 A5 03 A5 02 B1 02 A5 02 A5 01 A5 02 B1    ................
0260C0:  02 A5 02 A5 03 A5 02 B1 02 A5 02 A2 01 A2 02 AE    ................
0260D0:  02 A2 02 A2 03 A2 02 AE 02 A2 02 A2 01 A2 02 AE    ................
0260E0:  02 A2 02 A2 03 A2 02 AE 02 A2 02 A3 01 A3 02 AF    ...........£.£..
0260F0:  02 A3 01 A3 03 A3 02 AF 02 A3 02 A3 01 A3 02 AF    .£.£.£...£.£.£..
026100:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
026110:  20 00 01 00 02 09 50 E5 20 00 C1 02 00 00 00 02     .....P. .......
026120:  20 00 C6 02 00 00 00 02 20 00 C2 02 00 00 00 02     ....... .......
026130:  20 00 C7 02 00 00 00 02 20 00 C3 02 00 00 00 02     ....... .......
026140:  20 00 C8 02 00 00 00 02 20 00 C4 02 00 00 00 02     ....... .......
026150:  20 00 C9 02 00 00 00 02 20 00 C5 02 00 00 00 02     ....... .......
026160:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
026170:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
026180:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
026190:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0261A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0261B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0261C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0261D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0261E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0261F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
026200:  62 6C 65 20 64 27 65 66 66 61 63 65 6D 65 6E 74    ble d'effacement
026210:  20 64 65 20 6C 27 65 63 72 61 6E 0D 0A 20 20 20     de l'ecran..   
026220:  20 20 20 20 20 2A 20 75 6E 65 20 72 6F 75 74 69         * une routi
026230:  6E 65 20 64 27 61 6E 69 6D 61 74 69 6F 6E 20 28    ne d'animation (
026240:  70 6F 75 72 20 6C 65 73 20 70 72 65 73 65 6E 74    pour les present
026250:  61 74 69 6F 6E 73 20 65 6E 20 6D 6F 64 65 20 31    ations en mode 1
026260:  29 0D 0A 0D 0A 49 6C 20 65 73 74 20 70 6F 73 73    )....Il est poss
026270:  69 62 6C 65 20 64 65 20 70 61 72 61 6D 65 74 72    ible de parametr
026280:  65 72 20 64 27 61 75 74 72 65 73 20 66 6F 6E 63    er d'autres fonc
026290:  74 69 6F 6E 73 2C 20 61 75 20 6E 69 76 65 61 75    tions, au niveau
0262A0:  20 64 75 20 70 72 6F 67 72 61 6D 6D 65 20 64 65     du programme de
0262B0:  0D 0A 6C 69 61 69 73 6F 6E 20 64 65 73 20 66 69    ..liaison des fi
0262C0:  63 68 69 65 72 73 20 28 6C 65 20 4C 69 6E 6B 65    chiers (le Linke
0262D0:  72 29 2E 0D 0A 0D 0A 20 20 20 20 20 20 20 20 2A    r).....        *
0262E0:  20 6D 6F 64 65 20 67 72 61 70 68 69 71 75 65 20     mode graphique 
0262F0:  64 75 20 74 65 78 74 65 20 28 6D 6F 64 65 20 31    du texte (mode 1
026300:  20 6F 75 20 32 29 0D 0A 20 20 20 20 20 20 20 20     ou 2)..        
026310:  2A 20 6D 6F 64 65 20 67 72 61 70 68 69 71 75 65    * mode graphique
026320:  20 64 75 20 6C 6F 67 6F 20 28 6D 6F 64 65 20 31     du logo (mode 1
026330:  20 6F 75 20 32 29 0D 0A 20 20 20 20 20 20 20 20     ou 2)..        
026340:  2A 20 63 6F 75 6C 65 75 72 73 20 64 65 73 20 64    * couleurs des d
026350:  69 66 66 65 72 65 6E 74 73 20 65 6C 65 6D 65 6E    ifferents elemen
026360:  74 73 20 64 65 20 6C 61 20 70 72 65 73 65 6E 74    ts de la present
026370:  61 74 69 6F 6E 0D 0A 20 20 20 20 20 20 20 20 2A    ation..        *
026380:  20 61 66 66 69 63 68 61 67 65 20 64 27 75 6E 20     affichage d'un 
026390:  63 75 72 73 65 75 72 0D 0A 20 20 20 20 20 20 20    curseur..       
0263A0:  20 2A 20 76 69 74 65 73 73 65 20 64 27 61 66 66     * vitesse d'aff
0263B0:  69 63 68 61 67 65 20 64 75 20 74 65 78 74 65 20    ichage du texte 
0263C0:  73 69 20 6C 65 20 63 75 72 73 65 75 72 20 65 73    si le curseur es
0263D0:  74 20 73 65 6C 65 63 74 69 6F 6E 6E 65 0D 0A 20    t selectionne.. 
0263E0:  20 20 20 20 20 20 20 2A 20 61 66 66 69 63 68 61           * afficha
0263F0:  67 65 20 64 75 20 6D 65 73 73 61 67 65 20 27 50    ge du message 'P
026400:  65 72 0D 0A 20 20 20 20 20 20 20 20 20 20 20 20    er..            
026410:  20 20 20 20 20 20 20 20 54 65 78 74 65 20 70 72            Texte pr
026420:  65 73 65 6E 74 20 65 6E 20 6D 65 6D 6F 69 72 65    esent en memoire
026430:  2E 0D 0A 20 20 20 20 20 20 20 28 46 29 69 6C 65    ...       (F)ile
026440:  6E 61 6D 65 20 3A 20 73 61 69 73 69 65 20 64 75    name : saisie du
026450:  20 6E 6F 6D 20 64 75 20 66 69 63 68 69 65 72 20     nom du fichier 
026460:  64 65 20 74 72 61 76 61 69 6C 2E 20 55 6E 20 66    de travail. Un f
026470:  69 63 68 69 65 72 20 64 6F 69 74 20 6F 62 6C 69    ichier doit obli
026480:  2D 0D 0A 20 20 20 20 20 20 20 20 20 20 20 20 20    -..             
026490:  20 20 20 20 20 20 20 67 61 74 6F 69 72 65 6D 65           gatoireme
0264A0:  6E 74 20 65 74 72 65 20 6E 6F 6D 6D 65 20 61 76    nt etre nomme av
0264B0:  61 6E 74 20 73 61 20 73 61 75 76 65 67 61 72 64    ant sa sauvegard
0264C0:  65 20 6F 75 20 73 61 20 63 6F 6E 76 65 72 73 69    e ou sa conversi
0264D0:  6F 6E 0D 0A 20 20 20 20 20 20 20 20 20 20 20 20    on..            
0264E0:  20 20 20 20 20 20 20 20 65 6E 20 66 69 63 68 69            en fichi
0264F0:  65 72 20 54 65 78 74 65 20 43 6F 6D 70 72 65 73    er Texte Compres
026500:  73 65 2E 0D 0A 20 20 20 20 20 20 20 28 44 29 69    se...       (D)i
026510:  72 20 20 20 20 20 20 3A 20 63 61 74 61 6C 6F 67    r      : catalog
026520:  75 65 20 64 27 75 6E 65 20 64 69 73 71 75 65 74    ue d'une disquet
026530:  74 65 20 20 28 73 65 75 6C 73 20 6C 65 73 20 66    te  (seuls les f
026540:  69 63 68 69 65 72 73 20 20 54 65 78 74 65 20 20    ichiers  Texte  
026550:  47 2E 57 2E 0D 0A 20 20 20 20 20 20 20 20 20 20    G.W...          
026560:  20 20 20 20 20 20 20 20 20 20 73 6F 6E 74 20 61              sont a
026570:  66 66 69 63 68 65 73 29 2E 0D 0A 20 20 20 20 20    ffiches)...     
026580:  20 20 28 41 29 3A 20 20 20 20 20 20 20 3A 20 73      (A):       : s
026590:  65 6C 65 63 74 69 6F 6E 20 64 75 20 6C 65 63 74    election du lect
0265A0:  65 75 72 20 41 3A 20 63 6F 6D 6D 65 20 6C 65 63    eur A: comme lec
0265B0:  74 65 75 72 20 64 65 20 74 72 61 76 61 69 6C 2E    teur de travail.
0265C0:  0D 0A 20 20 20 20 20 20 20 28 42 29 3A 20 20 20    ..       (B):   
0265D0:  20 20 20 20 3A 20 73 65 6C 65 63 74 69 6F 6E 20        : selection 
0265E0:  64 75 20 6C 65 63 74 65 75 72 20 42 3A 20 63 6F    du lecteur B: co
0265F0:  6D 6D 65 20 6C 65 63 74 65 75 72 20 64 65 20 74    mme lecteur de t
026600:  72 65 73 73 20 73 70 61 63 65 20 74 6F 20 63 6F    ress space to co
026610:  6E 74 69 6E 75 65 27 20 61 20 6C 61 20 66 69 6E    ntinue' a la fin
026620:  20 64 27 75 6E 65 20 70 61 67 65 0D 0A 0D 0A 47     d'une page....G
026630:  68 6F 75 6C 27 73 20 77 72 69 74 65 72 20 73 65    houl's writer se
026640:  20 63 6F 6D 70 6F 73 65 20 64 65 20 70 6C 75 73     compose de plus
026650:  69 65 75 72 73 20 75 74 69 6C 69 74 61 69 72 65    ieurs utilitaire
026660:  73 20 3A 0D 0A 0D 0A 20 20 20 20 20 20 20 20 2A    s :....        *
026670:  20 75 6E 20 65 64 69 74 65 75 72 20 64 65 20 74     un editeur de t
026680:  65 78 74 65 20 74 72 65 73 20 73 69 6D 70 6C 65    exte tres simple
026690:  2C 20 70 65 72 6D 65 74 74 61 6E 74 20 64 65 20    , permettant de 
0266A0:  63 72 65 65 72 20 64 65 73 20 66 69 63 68 69 65    creer des fichie
0266B0:  72 73 0D 0A 20 20 20 20 20 20 20 20 20 20 74 65    rs..          te
0266C0:  78 74 65 20 61 75 20 66 6F 72 6D 61 74 20 47 68    xte au format Gh
0266D0:  6F 75 6C 27 73 20 57 72 69 74 65 72 2E 0D 0A 20    oul's Writer... 
0266E0:  20 20 20 20 20 20 20 2A 20 75 6E 20 67 65 6E 65           * un gene
0266F0:  72 61 74 65 75 72 20 64 65 20 66 69 63 68 69 65    rateur de fichie
026700:  72 20 65 78 65 63 75 74 61 62 6C 65 0D 0A 20 20    r executable..  
026710:  20 20 20 20 20 20 2A 20 75 6E 20 72 65 6C 6F 67          * un relog
026720:  65 75 72 20 64 65 20 6D 75 73 69 71 75 65 73 20    eur de musiques 
026730:  53 6F 75 6E 64 74 72 61 6B 6B 65 72 0D 0A 20 20    Soundtrakker..  
026740:  20 20 20 20 20 20 2A 20 75 6E 20 63 72 65 61 74          * un creat
026750:  65 75 72 20 64 65 20 6C 6F 67 6F 73 0D 0A 20 20    eur de logos..  
026760:  20 20 20 20 20 20 2A 20 75 6E 20 63 72 65 61 74          * un creat
026770:  65 75 72 20 64 65 20 66 69 63 68 69 65 72 73 20    eur de fichiers 
026780:  2E 46 4E 54 20 61 20 70 61 72 74 69 72 20 64 65    .FNT a partir de
026790:  20 66 6F 6E 74 65 73 20 42 61 73 69 63 0D 0A 0D     fontes Basic...
0267A0:  0A 43 68 61 63 75 6E 20 64 65 20 63 65 73 20 70    .Chacun de ces p
0267B0:  72 6F 67 72 61 6D 6D 65 73 20 66 61 69 74 20 6C    rogrammes fait l
0267C0:  27 6F 62 6A 65 74 20 64 27 75 6E 20 70 61 72 61    'objet d'un para
0267D0:  67 72 61 70 68 65 20 64 61 6E 73 20 63 65 74 74    graphe dans cett
0267E0:  65 20 64 6F 63 75 6D 65 6E 74 61 74 69 6F 6E 2E    e documentation.
0267F0:  0D 0A 4C 65 73 20 61 64 65 70 74 65 73 20 64 65    ..Les adeptes de
026800:  72 61 76 61 69 6C 2E 20 0D 0A 0D 0A 20 20 20 20    ravail. ....    
026810:  43 6F 6D 6D 61 6E 64 65 73 20 64 65 20 6C 27 65    Commandes de l'e
026820:  64 69 74 65 75 72 20 3A 20 20 20 20 0D 0A 0D 0A    diteur :    ....
026830:  20 20 20 20 20 20 20 28 45 53 43 29 20 20 20 20           (ESC)    
026840:  20 20 20 20 20 20 20 20 20 3A 20 72 65 74 6F 75             : retou
026850:  72 20 61 75 20 6D 65 6E 75 20 67 65 6E 65 72 61    r au menu genera
026860:  6C 0D 0A 20 20 20 20 20 20 20 28 52 45 54 55 52    l..       (RETUR
026870:  4E 29 20 20 20 20 20 20 20 20 20 20 3A 20 70 61    N)          : pa
026880:  73 73 61 67 65 20 61 20 6C 61 20 6C 69 67 6E 65    ssage a la ligne
026890:  20 73 75 69 76 61 6E 74 65 0D 0A 20 20 20 20 20     suivante..     
0268A0:  20 20 28 43 4F 50 59 29 20 20 20 20 20 20 20 20      (COPY)        
0268B0:  20 20 20 20 3A 20 49 6E 73 65 72 74 69 6F 6E 20        : Insertion 
0268C0:  64 27 75 6E 20 63 61 72 61 63 74 65 72 65 20 73    d'un caractere s
0268D0:  75 72 20 75 6E 65 20 6C 69 67 6E 65 0D 0A 20 20    ur une ligne..  
0268E0:  20 20 20 20 20 28 44 45 4C 29 20 26 20 28 43 4C         (DEL) & (CL
0268F0:  52 29 20 20 20 20 20 3A 20 45 66 66 61 63 65 6D    R)     : Effacem
026900:  65 6E 74 20 64 27 75 6E 20 63 61 72 61 63 74 65    ent d'un caracte
026910:  72 65 20 73 75 72 20 75 6E 65 20 6C 69 67 6E 65    re sur une ligne
026920:  0D 0A 20 20 20 20 20 20 20 28 54 41 42 29 20 20    ..       (TAB)  
026930:  20 20 20 20 20 20 20 20 20 20 20 3A 20 64 65 70               : dep
026940:  6C 61 63 65 6D 65 6E 74 20 64 75 20 63 75 72 73    lacement du curs
026950:  65 75 72 20 64 65 20 58 20 63 61 72 61 63 74 65    eur de X caracte
026960:  72 65 73 0D 0A 20 20 20 20 20 20 20 28 53 48 49    res..       (SHI
026970:  46 54 29 20 2B 20 28 4C 45 46 54 29 20 20 3A 20    FT) + (LEFT)  : 
026980:  49 6E 73 65 72 74 69 6F 6E 20 64 27 75 6E 20 63    Insertion d'un c
026990:  61 72 61 63 74 65 72 65 20 73 75 72 20 74 6F 75    aractere sur tou
0269A0:  74 20 6C 65 20 74 65 78 74 65 0D 0A 20 20 20 20    t le texte..    
0269B0:  20 20 20 28 53 48 49 46 54 29 20 2B 20 28 52 49       (SHIFT) + (RI
0269C0:  47 48 54 29 20 3A 20 45 66 66 61 63 65 6D 65 6E    GHT) : Effacemen
0269D0:  74 20 64 27 75 6E 20 63 61 72 61 63 74 65 72 65    t d'un caractere
0269E0:  20 73 75 72 20 74 6F 75 74 20 6C 65 20 74 65 78     sur tout le tex
0269F0:  74 65 0D 0A 20 20 20 20 20 20 20 28 53 48 49 46    te..       (SHIF
026A00:  20 6C 27 61 73 73 65 6D 62 6C 65 75 72 20 20 74     l'assembleur  t
026A10:  72 6F 75 76 65 72 6F 6E 74 20 20 65 6E 20 66 69    rouveront  en fi
026A20:  6E 20 64 65 20 6E 6F 74 69 63 65 20 6C 65 20 66    n de notice le f
026A30:  6F 72 6D 61 74 20 64 65 20 74 6F 75 73 20 6C 65    ormat de tous le
026A40:  73 0D 0A 66 69 63 68 69 65 72 73 20 70 61 72 61    s..fichiers para
026A50:  6D 65 74 72 65 73 20 64 65 20 47 68 6F 75 6C 27    metres de Ghoul'
026A60:  73 20 57 72 69 74 65 72 2E 20 20 20 49 6C 73 20    s Writer.   Ils 
026A70:  70 6F 75 72 72 6F 6E 74 20 61 69 6E 73 69 20 63    pourront ainsi c
026A80:  72 65 65 72 20 6C 65 75 72 73 20 70 72 6F 70 72    reer leurs propr
026A90:  65 73 0D 0A 61 6E 69 6D 61 74 69 6F 6E 73 20 20    es..animations  
026AA0:  6F 75 20 74 61 62 6C 65 73 20 64 27 65 66 66 61    ou tables d'effa
026AB0:  63 65 6D 65 6E 74 2E 20 20 20 4C 65 73 20 75 74    cement.   Les ut
026AC0:  69 6C 69 73 61 74 65 75 72 73 20 20 70 72 65 73    ilisateurs  pres
026AD0:  73 65 73 20 64 65 20 76 6F 69 72 20 20 63 65 20    ses de voir  ce 
026AE0:  71 75 65 0D 0A 70 65 75 74 20 66 61 69 72 65 20    que..peut faire 
026AF0:  47 68 6F 75 6C 27 73 20 57 72 69 74 65 72 20 70    Ghoul's Writer p
026B00:  65 75 76 65 6E 74 20 6C 61 6E 63 65 72 20 6C 65    euvent lancer le
026B10:  20 66 69 63 68 69 65 72 20 2D 47 57 44 45 4D 4F     fichier -GWDEMO
026B20:  2E 42 49 4E 2E 0D 0A 0D 0A 0D 0A 49 49 20 47 57    .BIN.......II GW
026B30:  45 44 49 54 2C 20 6C 27 65 64 69 74 65 75 72 20    EDIT, l'editeur 
026B40:  64 65 20 74 65 78 74 65 0D 0A 0D 0A 4C 6F 72 73    de texte....Lors
026B50:  20 64 65 20 6C 61 20 70 72 6F 67 72 61 6D 6D 61     de la programma
026B60:  74 69 6F 6E 20 64 65 20 47 2E 57 20 73 27 65 73    tion de G.W s'es
026B70:  74 20 70 6F 73 65 20 6C 65 20 70 72 6F 62 6C 65    t pose le proble
026B80:  6D 65 20 64 65 20 20 6C 61 20 73 74 72 75 63 74    me de  la struct
026B90:  75 72 65 20 64 75 20 74 65 78 2D 0D 0A 74 65 2E    ure du tex-..te.
026BA0:  20 20 41 70 72 65 73 20 61 76 6F 69 72 20 65 74      Apres avoir et
026BB0:  75 64 69 65 20 6C 65 73 20 66 6F 72 6D 61 74 73    udie les formats
026BC0:  20 67 65 6E 65 72 65 73 20 20 70 61 72 20 63 65     generes  par ce
026BD0:  72 74 61 69 6E 73 20 20 74 72 61 69 74 65 6D 65    rtains  traiteme
026BE0:  6E 74 73 20 64 65 20 74 65 78 74 65 0D 0A 6F 75    nts de texte..ou
026BF0:  20 65 64 69 74 65 75 72 73 20 65 78 69 73 74 61     editeurs exista
026C00:  54 29 20 2B 20 28 55 50 29 20 20 20 20 3A 20 45    T) + (UP)    : E
026C10:  66 66 61 63 65 6D 65 6E 74 20 64 27 75 6E 65 20    ffacement d'une 
026C20:  6C 69 67 6E 65 0D 0A 20 20 20 20 20 20 20 28 53    ligne..       (S
026C30:  48 49 46 54 29 20 2B 20 28 44 4F 57 4E 29 20 20    HIFT) + (DOWN)  
026C40:  3A 20 49 6E 73 65 72 74 69 6F 6E 20 64 27 75 6E    : Insertion d'un
026C50:  65 20 6C 69 67 6E 65 0D 0A 20 20 20 20 20 20 20    e ligne..       
026C60:  28 43 54 52 4C 29 20 20 2B 20 28 4C 45 46 54 29    (CTRL)  + (LEFT)
026C70:  20 20 3A 20 50 61 67 65 20 70 72 65 63 65 64 65      : Page precede
026C80:  6E 74 65 0D 0A 20 20 20 20 20 20 20 28 43 54 52    nte..       (CTR
026C90:  4C 29 20 20 2B 20 28 52 49 47 48 54 29 20 3A 20    L)  + (RIGHT) : 
026CA0:  50 61 67 65 20 73 75 69 76 61 6E 74 65 0D 0A 20    Page suivante.. 
026CB0:  20 20 20 20 20 20 28 43 55 52 53 4F 52 20 4B 45          (CURSOR KE
026CC0:  59 53 29 20 20 20 20 20 3A 20 64 65 70 6C 61 63    YS)     : deplac
026CD0:  65 6D 65 6E 74 20 64 75 20 63 75 72 73 65 75 72    ement du curseur
026CE0:  0D 0A 20 20 20 20 20 20 20 28 46 30 29 20 61 20    ..       (F0) a 
026CF0:  28 46 39 29 20 20 20 20 20 20 20 3A 20 61 66 66    (F9)       : aff
026D00:  69 63 68 65 20 75 6E 20 63 61 72 61 63 74 65 72    iche un caracter
026D10:  65 20 73 70 65 63 69 61 6C 0D 0A 0D 0A 20 20 20    e special....   
026D20:  20 20 20 20 20 0D 0A 32 29 20 52 65 6D 61 72 71         ..2) Remarq
026D30:  75 65 73 20 67 65 6E 65 72 61 6C 65 73 20 3A 0D    ues generales :.
026D40:  0A 0D 0A 20 20 20 47 77 65 64 69 74 20 70 65 72    ...   Gwedit per
026D50:  6D 65 74 20 64 65 20 67 65 72 65 72 20 64 65 73    met de gerer des
026D60:  20 74 65 78 74 65 20 64 65 20 31 39 20 70 61 67     texte de 19 pag
026D70:  65 73 20 65 6E 20 6D 6F 64 65 20 32 20 6F 75 20    es en mode 2 ou 
026D80:  33 38 20 70 61 67 65 73 20 65 6E 20 6D 6F 64 65    38 pages en mode
026D90:  0D 0A 20 20 20 31 2E 20 44 65 75 78 20 27 66 6F    ..   1. Deux 'fo
026DA0:  72 6D 61 74 73 27 20 64 65 20 74 65 78 74 65 20    rmats' de texte 
026DB0:  73 6F 6E 74 20 75 74 69 6C 69 73 65 73 20 70 61    sont utilises pa
026DC0:  72 20 47 57 65 64 69 74 20 3A 0D 0A 0D 0A 20 20    r GWedit :....  
026DD0:  20 20 20 20 20 2A 20 6C 65 20 66 6F 72 6D 61 74         * le format
026DE0:  20 54 65 78 74 65 20 28 65 78 74 65 6E 73 69 6F     Texte (extensio
026DF0:  6E 20 2E 47 57 54 29 20 3A 20 20 0D 0A 0D 0A 20    n .GWT) :  .... 
026E00:  6E 74 73 2C 20 20 6A 27 61 69 20 64 65 63 69 64    nts,  j'ai decid
026E10:  65 20 64 65 20 63 72 65 65 72 20 20 75 6E 20 65    e de creer  un e
026E20:  64 69 74 65 75 72 20 70 6F 75 72 20 47 2E 57 2C    diteur pour G.W,
026E30:  20 47 57 65 64 69 74 2E 20 50 72 6F 2D 0D 0A 67     GWedit. Pro-..g
026E40:  72 61 6D 6D 65 20 72 61 70 69 64 65 6D 65 6E 74    ramme rapidement
026E50:  2C 20 20 69 6C 20 6E 65 20 70 65 75 74 20 70 72    ,  il ne peut pr
026E60:  65 74 65 6E 64 72 65 20 20 65 67 61 6C 65 72 20    etendre  egaler 
026E70:  6C 65 73 20 6D 65 69 6C 6C 65 75 72 65 73 20 70    les meilleures p
026E80:  72 6F 64 75 63 74 69 6F 6E 73 20 73 75 72 0D 0A    roductions sur..
026E90:  43 50 43 2E 0D 0A 0D 0A 31 29 20 4C 65 73 20 63    CPC.....1) Les c
026EA0:  6F 6D 6D 61 6E 64 65 73 20 64 65 20 47 57 45 44    ommandes de GWED
026EB0:  49 54 0D 0A 0D 0A 20 20 20 43 6F 6D 6D 61 6E 64    IT....   Command
026EC0:  65 73 20 64 75 20 6D 65 6E 75 20 67 65 6E 65 72    es du menu gener
026ED0:  61 6C 20 3A 0D 0A 0D 0A 20 20 20 20 20 20 20 28    al :....       (
026EE0:  4E 29 65 77 20 74 65 78 74 20 3A 20 73 61 69 73    N)ew text : sais
026EF0:  69 65 20 64 27 75 6E 20 6E 6F 75 76 65 61 75 20    ie d'un nouveau 
026F00:  74 65 78 74 65 2E 20 20 53 69 20 75 6E 20 61 6E    texte.  Si un an
026F10:  63 69 65 6E 20 74 65 78 74 65 20 65 73 74 20 70    cien texte est p
026F20:  72 65 73 65 6E 74 0D 0A 20 20 20 20 20 20 20 20    resent..        
026F30:  20 20 20 20 20 20 20 20 20 20 20 20 65 6E 20 6D                en m
026F40:  65 6D 6F 69 72 65 2C 20 69 6C 20 65 73 74 20 65    emoire, il est e
026F50:  66 66 61 63 65 2E 20 4C 61 20 73 65 6C 65 63 74    fface. La select
026F60:  69 6F 6E 20 64 75 20 6D 6F 64 65 20 64 65 20 74    ion du mode de t
026F70:  72 61 76 61 69 6C 0D 0A 20 20 20 20 20 20 20 20    ravail..        
026F80:  20 20 20 20 20 20 20 20 20 20 20 20 64 75 20 74                du t
026F90:  65 78 74 65 20 20 28 6D 6F 64 65 20 31 20 6F 75    exte  (mode 1 ou
026FA0:  20 32 29 20 73 65 20 66 61 69 20 74 20 75 6E 69     2) se fai t uni
026FB0:  71 75 65 6D 65 6E 74 20 73 75 72 20 63 65 74 74    quement sur cett
026FC0:  65 20 63 6F 6D 2D 0D 0A 20 20 20 20 20 20 20 20    e com-..        
026FD0:  20 20 20 20 20 20 20 20 20 20 20 20 6D 61 6E 64                mand
026FE0:  65 2E 0D 0A 20 20 20 20 20 20 20 28 45 29 64 69    e...       (E)di
026FF0:  74 20 20 20 20 20 3A 20 65 64 69 74 69 6F 6E 20    t     : edition 
027000:  20 20 20 20 20 20 20 20 43 65 20 66 6F 72 6D 61            Ce forma
027010:  74 20 20 6E 65 20 63 6F 6D 70 6F 72 74 65 20 20    t  ne comporte  
027020:  61 75 63 75 6E 20 63 61 72 61 63 74 65 72 65 20    aucun caractere 
027030:  64 65 20 63 6F 6E 74 72 6F 6C 65 2C 20 6D 69 73    de controle, mis
027040:  20 61 20 70 61 72 74 20 6C 65 20 31 65 72 0D 0A     a part le 1er..
027050:  20 20 20 20 20 20 20 20 20 6F 63 74 65 74 20 64             octet d
027060:  75 20 74 65 78 74 65 2C 20 71 75 69 20 73 65 72    u texte, qui ser
027070:  74 20 61 20 64 65 74 65 72 6D 69 6E 65 72 20 73    t a determiner s
027080:  6F 6E 20 6D 6F 64 65 20 64 27 61 66 66 69 63 68    on mode d'affich
027090:  61 67 65 20 28 6D 6F 64 65 20 31 2C 20 33 37 0D    age (mode 1, 37.
0270A0:  0A 20 20 20 20 20 20 20 20 20 63 6F 6C 6F 6E 6E    .         colonn
0270B0:  65 73 20 6F 75 20 6D 6F 64 65 20 32 2C 20 37 38    es ou mode 2, 78
0270C0:  20 63 6F 6C 6F 6E 6E 65 73 29 2E 20 20 43 65 74     colonnes).  Cet
0270D0:  74 65 20 65 78 74 72 65 6D 65 20 73 69 6D 70 6C    te extreme simpl
0270E0:  69 63 69 74 65 20 20 70 65 72 6D 65 74 20 64 65    icite  permet de
0270F0:  0D 0A 20 20 20 20 20 20 20 20 20 73 65 20 73 65    ..         se se
027100:  72 76 69 72 20 64 65 20 63 65 20 66 6F 72 6D 61    rvir de ce forma
027110:  74 20 70 6F 75 72 20 74 61 70 65 72 20 75 6E 20    t pour taper un 
027120:  74 65 78 74 65 20 64 65 73 74 69 6E 65 20 61 20    texte destine a 
027130:  75 6E 20 73 63 72 6F 6C 6C 69 6E 67 2E 0D 0A 0D    un scrolling....
027140:  0A 20 20 20 20 20 20 20 2A 20 6C 65 20 66 6F 72    .       * le for
027150:  6D 61 74 20 54 65 78 74 65 20 43 6F 6D 70 72 65    mat Texte Compre
027160:  73 73 65 20 28 65 78 74 65 6E 73 69 6F 6E 20 2E    sse (extension .
027170:  47 57 43 29 0D 0A 0D 0A 20 20 20 20 20 20 20 20    GWC)....        
027180:  20 4F 62 74 65 6E 75 20 61 20 70 61 72 74 69 72     Obtenu a partir
027190:  20 64 27 75 6E 20 66 69 63 68 69 65 72 20 61 75     d'un fichier au
0271A0:  20 66 6F 72 6D 61 74 20 54 65 78 74 65 2C 20 63     format Texte, c
0271B0:  65 20 66 6F 72 6D 61 74 20 67 65 72 65 20 70 6C    e format gere pl
0271C0:  75 73 69 65 75 72 73 0D 0A 20 20 20 20 20 20 20    usieurs..       
0271D0:  20 20 63 61 72 61 63 74 65 72 65 73 20 64 65 20      caracteres de 
0271E0:  63 6F 6E 74 72 6F 6C 65 2E 20 43 27 65 73 74 20    controle. C'est 
0271F0:  63 65 20 66 6F 72 6D 61 74 20 71 75 69 20 65 73    ce format qui es
027200:  64 75 20 74 65 78 74 65 20 65 78 69 73 74 61 6E    du texte existan
027210:  74 2E 0D 0A 20 20 20 20 20 20 20 28 48 29 65 6C    t...       (H)el
027220:  70 20 20 20 20 20 3A 20 6C 69 73 74 65 20 64 65    p     : liste de
027230:  73 20 63 6F 6D 6D 61 6E 64 65 73 20 64 65 20 6C    s commandes de l
027240:  27 65 64 69 74 65 75 72 2E 0D 0A 20 20 20 20 20    'editeur...     
027250:  20 20 28 54 29 61 62 20 20 20 20 20 20 3A 20 63      (T)ab      : c
027260:  68 6F 69 78 20 64 65 20 6C 27 65 73 70 61 63 65    hoix de l'espace
027270:  6D 65 6E 74 20 65 6E 74 72 65 20 64 65 75 78 20    ment entre deux 
027280:  74 61 62 75 6C 61 74 69 6F 6E 73 0D 0A 20 20 20    tabulations..   
027290:  20 20 20 20 28 4F 29 70 65 6E 20 20 20 20 20 3A        (O)pen     :
0272A0:  20 63 68 61 72 67 65 6D 65 6E 74 20 64 27 75 6E     chargement d'un
0272B0:  20 66 69 63 68 69 65 72 20 54 65 78 74 65 20 61     fichier Texte a
0272C0:  75 20 66 6F 72 6D 61 74 20 47 2E 57 2E 0D 0A 20    u format G.W... 
0272D0:  20 20 20 20 20 20 28 53 29 61 76 65 20 20 20 20          (S)ave    
0272E0:  20 3A 20 73 61 75 76 65 67 61 72 64 65 20 64 27     : sauvegarde d'
0272F0:  75 6E 20 66 69 63 68 69 65 72 20 54 65 78 74 65    un fichier Texte
027300:  20 61 75 20 66 6F 72 6D 61 74 20 47 2E 57 2E 0D     au format G.W..
027310:  0A 20 20 20 20 20 20 20 28 43 29 6F 6E 76 65 72    .       (C)onver
027320:  74 20 20 3A 20 63 6F 6E 76 65 72 73 69 6F 6E 20    t  : conversion 
027330:  70 75 69 73 20 73 61 75 76 65 67 61 72 64 65 20    puis sauvegarde 
027340:  64 27 75 6E 20 66 69 63 68 69 65 72 20 43 6F 6D    d'un fichier Com
027350:  70 72 65 73 73 65 20 61 75 20 66 6F 72 6D 61 74    presse au format
027360:  0D 0A 20 20 20 20 20 20 20 20 20 20 20 20 20 20    ..              
027370:  20 20 20 20 20 20 47 2E 57 2E 20 20 43 27 65 73          G.W.  C'es
027380:  74 20 63 65 20 66 6F 72 6D 61 74 20 71 75 69 20    t ce format qui 
027390:  65 73 74 20 75 74 69 6C 69 73 65 20 70 61 72 20    est utilise par 
0273A0:  6C 65 20 4C 69 6E 6B 65 72 20 64 65 20 47 2E 57    le Linker de G.W
0273B0:  2E 0D 0A 20 20 20 20 20 20 20 20 20 20 20 20 20    ...             
0273C0:  20 20 20 20 20 20 20 41 74 74 65 6E 74 69 6F 6E           Attention
0273D0:  20 21 20 20 4C 61 20 63 6F 6E 76 65 72 73 69 6F     !  La conversio
0273E0:  6E 20 20 64 27 75 6E 20 74 65 78 74 65 20 20 65    n  d'un texte  e
0273F0:  66 66 61 63 65 20 20 6C 65 20 20 66 69 63 68 69    fface  le  fichi
027400:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
027410:  21 00 01 00 02 09 4E E5 21 00 C1 02 00 00 00 02    !.....N.!.......
027420:  21 00 C6 02 00 00 00 02 21 00 C2 02 00 00 00 02    !.......!.......
027430:  21 00 C7 02 00 00 00 02 21 00 C3 02 00 00 00 02    !.......!.......
027440:  21 00 C8 02 00 00 00 02 21 00 C4 02 00 00 00 02    !.......!.......
027450:  21 00 C9 02 00 00 00 02 21 00 C5 02 00 00 00 02    !.......!.......
027460:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
027470:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
027480:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
027490:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0274A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0274B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0274C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0274D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0274E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0274F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
027500:  74 20 75 74 69 6C 69 73 65 20 20 70 61 72 20 6C    t utilise  par l
027510:  65 20 6C 69 6E 6B 65 72 0D 0A 20 20 20 20 20 20    e linker..      
027520:  20 20 20 64 65 20 47 2E 57 2E 20 41 74 74 65 6E       de G.W. Atten
027530:  74 69 6F 6E 20 21 20 47 57 45 44 49 54 20 6E 65    tion ! GWEDIT ne
027540:  20 70 65 75 74 20 72 65 6C 69 72 65 20 64 65 73     peut relire des
027550:  20 74 65 78 74 65 73 20 63 6F 6D 70 72 65 73 73     textes compress
027560:  65 73 2E 0D 0A 20 20 20 20 20 20 20 20 20 53 61    es...         Sa
027570:  75 76 65 67 61 72 64 65 7A 20 64 6F 6E 63 20 76    uvegardez donc v
027580:  6F 74 72 65 20 74 65 78 74 65 20 61 76 61 6E 74    otre texte avant
027590:  20 64 65 20 66 61 69 72 65 20 75 6E 65 20 63 6F     de faire une co
0275A0:  6E 76 65 72 73 69 6F 6E 2E 0D 0A 0D 0A 20 20 20    nversion.....   
0275B0:  20 50 6F 75 72 20 65 67 61 79 65 72 20 75 6E 20     Pour egayer un 
0275C0:  70 65 75 20 6C 65 73 20 74 65 78 74 65 73 20 64    peu les textes d
0275D0:  65 20 47 2E 57 2C 20 69 6C 20 65 73 74 20 70 6F    e G.W, il est po
0275E0:  73 73 69 62 6C 65 20 64 27 75 74 69 6C 69 73 65    ssible d'utilise
0275F0:  72 20 64 65 73 20 63 61 72 61 63 2D 0D 0A 20 20    r des carac-..  
027600:  20 20 74 65 72 65 73 20 73 70 65 63 69 61 75 78      teres speciaux
027610:  2E 20 43 65 75 78 2D 63 69 20 73 6F 6E 74 20 61    . Ceux-ci sont a
027620:  75 20 6E 6F 6D 62 72 65 20 64 65 20 31 30 2E 20    u nombre de 10. 
027630:  49 6C 73 20 70 65 75 76 65 6E 74 20 65 76 65 6E    Ils peuvent even
027640:  74 75 65 6C 6C 65 6D 65 6E 74 20 65 2D 0D 0A 20    tuellement e-.. 
027650:  20 20 20 74 72 65 20 20 72 65 64 65 66 69 6E 69       tre  redefini
027660:  73 20 20 65 6E 20 75 74 69 6C 69 73 61 6E 74 20    s  en utilisant 
027670:  20 75 6E 20 66 69 63 68 69 65 72 20 20 70 65 72     un fichier  per
027680:  73 6F 6E 6E 65 6C 20 61 20 6C 61 20 70 6C 61 63    sonnel a la plac
027690:  65 20 20 64 75 20 20 66 69 63 68 69 65 72 0D 0A    e  du  fichier..
0276A0:  20 20 20 20 4D 4F 52 45 2D 43 48 52 2E 44 41 54        MORE-CHR.DAT
0276B0:  20 20 64 61 6E 73 20 6C 65 20 6C 6F 61 64 65 72      dans le loader
0276C0:  20 2D 47 57 45 44 49 54 2E 42 41 53 2E 20 20 4C     -GWEDIT.BAS.  L
0276D0:  65 20 66 69 63 68 69 65 72 20 41 43 43 45 4E 54    e fichier ACCENT
0276E0:  53 2E 44 41 54 20 76 6F 75 73 20 70 65 72 2D 0D    S.DAT vous per-.
0276F0:  0A 20 20 20 20 6D 65 74 20 70 61 72 20 65 78 65    .    met par exe
027700:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
027710:  20 20 20 20 20 20 28 62 61 73 29 20 70 65 72 6D          (bas) perm
027720:  65 74 74 65 6E 74 20 64 65 20 73 65 20 64 65 70    ettent de se dep
027730:  6C 61 63 65 72 20 64 61 6E 73 20 6C 61 20 6C 69    lacer dans la li
027740:  73 74 65 20 64 65 73 20 70 61 72 61 2D 0D 0A 20    ste des para-.. 
027750:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
027760:  20 20 20 20 20 6D 65 74 72 65 73 2C 20 28 64 72         metres, (dr
027770:  6F 69 74 65 29 20 65 74 20 28 67 61 75 63 68 65    oite) et (gauche
027780:  29 20 6D 6F 64 69 66 69 65 6E 74 20 6C 65 75 72    ) modifient leur
027790:  73 20 76 61 6C 65 75 72 73 2C 0D 0A 20 20 20 20    s valeurs,..    
0277A0:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
0277B0:  20 20 28 45 53 43 29 20 70 65 72 6D 65 74 20 64      (ESC) permet d
0277C0:  65 20 72 65 76 65 6E 69 72 20 61 75 20 6D 65 6E    e revenir au men
0277D0:  75 2E 0D 0A 20 20 20 20 20 20 20 28 56 29 69 65    u...       (V)ie
0277E0:  77 20 69 6E 74 72 6F 20 3A 20 76 69 73 75 61 6C    w intro : visual
0277F0:  69 73 61 74 69 6F 6E 20 20 64 65 20 6C 61 20 70    isation  de la p
027800:  72 65 73 65 6E 74 61 74 69 6F 6E 20 2E 20 4C 61    resentation . La
027810:  20 74 6F 75 63 68 65 20 28 45 53 43 29 20 70 65     touche (ESC) pe
027820:  72 2D 0D 0A 20 20 20 20 20 20 20 20 20 20 20 20    r-..            
027830:  20 20 20 20 20 20 20 20 20 20 6D 65 74 20 64 65              met de
027840:  20 72 65 76 65 6E 69 72 20 61 75 20 6D 65 6E 75     revenir au menu
027850:  2E 20 20 43 65 74 74 65 20 6F 70 74 69 6F 6E 20    .  Cette option 
027860:  20 6E 65 20 66 6F 6E 63 74 69 6F 6E 6E 65 20 71     ne fonctionne q
027870:  75 65 0D 0A 20 20 20 20 20 20 20 20 20 20 20 20    ue..            
027880:  20 20 20 20 20 20 20 20 20 20 71 75 61 6E 64 20              quand 
027890:  74 6F 75 73 20 6C 65 73 20 20 65 6C 65 6D 65 6E    tous les  elemen
0278A0:  74 73 20 64 27 75 6E 65 20 70 72 65 73 65 6E 74    ts d'une present
0278B0:  61 74 69 6F 6E 20 73 6F 6E 74 20 63 68 61 72 67    ation sont charg
0278C0:  65 73 0D 0A 20 20 20 20 20 20 20 20 20 20 20 20    es..            
0278D0:  20 20 20 20 20 20 20 20 20 20 65 6E 20 6D 65 6D              en mem
0278E0:  6F 69 72 65 2E 20 41 20 6E 6F 74 65 72 20 71 75    oire. A noter qu
0278F0:  65 20 70 6F 75 72 20 75 6E 65 20 70 72 65 73 65    e pour une prese
027900:  6D 70 6C 65 20 64 27 75 74 69 6C 69 73 65 72 20    mple d'utiliser 
027910:  64 61 6E 73 20 76 6F 73 20 74 65 78 74 65 73 20    dans vos textes 
027920:  20 64 65 73 20 61 63 63 65 6E 74 73 20 63 69 72     des accents cir
027930:  63 6F 6E 66 6C 65 78 65 73 20 65 74 20 64 65 73    conflexes et des
027940:  0D 0A 20 20 20 20 74 72 65 6D 61 73 2E 20 20 43    ..    tremas.  C
027950:  65 73 20 66 69 63 68 69 65 72 73 20 20 6E 65 20    es fichiers  ne 
027960:  64 65 66 69 6E 69 73 73 61 6E 74 20 20 71 75 65    definissant  que
027970:  20 64 69 78 20 20 63 61 72 61 63 74 65 72 65 73     dix  caracteres
027980:  20 73 6F 6E 74 20 65 6E 20 66 61 69 74 20 64 65     sont en fait de
027990:  73 0D 0A 20 20 20 20 66 69 63 68 69 65 72 73 20    s..    fichiers 
0279A0:  2E 46 4E 54 20 74 72 6F 6E 71 75 65 73 20 28 6C    .FNT tronques (l
0279B0:  6F 6E 67 75 65 75 72 20 3D 20 38 30 20 6F 63 74    ongueur = 80 oct
0279C0:  65 74 73 29 2E 0D 0A 0D 0A 20 20 20 20 49 6C 20    ets).....    Il 
0279D0:  65 73 74 20 20 65 67 61 6C 65 6D 65 6E 74 20 20    est  egalement  
0279E0:  70 6F 73 73 69 62 6C 65 20 20 64 65 20 20 63 68    possible  de  ch
0279F0:  61 6E 67 65 72 20 20 6C 61 20 66 6F 6E 74 65 20    anger  la fonte 
027A00:  64 65 20 74 72 61 76 61 69 6C 20 20 61 75 20 6E    de travail  au n
027A10:  69 76 65 61 75 20 64 65 0D 0A 20 20 20 20 47 57    iveau de..    GW
027A20:  45 44 49 54 20 65 6E 20 6D 6F 64 69 66 69 61 6E    EDIT en modifian
027A30:  74 20 20 6C 65 20 6C 6F 61 64 65 72 20 20 2D 47    t  le loader  -G
027A40:  57 45 44 49 54 2E 42 41 53 2E 20 50 61 72 20 64    WEDIT.BAS. Par d
027A50:  65 66 61 75 74 2C 20 20 6C 61 20 66 6F 6E 74 65    efaut,  la fonte
027A60:  20 20 73 79 73 74 65 6D 65 0D 0A 20 20 20 20 61      systeme..    a
027A70:  6E 67 6C 61 69 73 65 20 65 73 74 20 75 74 69 6C    nglaise est util
027A80:  69 73 65 20 20 28 66 69 63 68 69 65 72 20 53 59    ise  (fichier SY
027A90:  53 2D 55 4B 2E 46 4E 54 29 2E 20 4C 65 73 20 75    S-UK.FNT). Les u
027AA0:  74 69 6C 69 73 61 74 65 75 72 73 20 66 72 61 6E    tilisateurs fran
027AB0:  63 61 69 73 20 70 6F 75 72 2D 0D 0A 20 20 20 20    cais pour-..    
027AC0:  72 6F 6E 74 20 20 72 65 74 72 6F 75 76 65 72 20    ront  retrouver 
027AD0:  20 6C 65 75 72 73 20 63 68 65 72 73 20 20 61 63     leurs chers  ac
027AE0:  63 65 6E 74 73 20 20 65 6E 20 20 6D 65 74 74 61    cents  en  metta
027AF0:  6E 74 20 20 61 20 6C 61 20 70 6C 61 63 65 20 20    nt  a la place  
027B00:  6E 74 61 74 69 6F 6E 20 65 6E 20 6D 6F 64 65 20    ntation en mode 
027B10:  32 2C 0D 0A 20 20 20 20 20 20 20 20 20 20 20 20    2,..            
027B20:  20 20 20 20 20 20 20 20 20 20 6C 61 20 70 72 65              la pre
027B30:  73 65 6E 63 65 20 64 27 75 6E 20 66 69 63 68 69    sence d'un fichi
027B40:  65 72 20 20 64 27 61 6E 69 6D 61 74 69 6F 6E 20    er  d'animation 
027B50:  20 28 2E 47 57 58 29 20 20 6E 27 65 73 74 20 70     (.GWX)  n'est p
027B60:  61 73 0D 0A 20 20 20 20 20 20 20 20 20 20 20 20    as..            
027B70:  20 20 20 20 20 20 20 20 20 20 6E 65 63 65 73 73              necess
027B80:  61 69 72 65 2E 20 20 4C 65 73 20 6E 6F 6D 73 20    aire.  Les noms 
027B90:  20 64 65 73 20 66 69 63 68 69 65 72 73 20 20 63     des fichiers  c
027BA0:  68 61 72 67 65 73 20 20 65 6E 20 6D 65 6D 6F 69    harges  en memoi
027BB0:  72 65 0D 0A 20 20 20 20 20 20 20 20 20 20 20 20    re..            
027BC0:  20 20 20 20 20 20 20 20 20 20 73 6F 6E 74 20 61              sont a
027BD0:  66 66 69 63 68 65 73 20 61 76 61 6E 74 20 6C 65    ffiches avant le
027BE0:  20 6C 61 6E 63 65 6D 65 6E 74 20 64 65 20 6C 27     lancement de l'
027BF0:  69 6E 74 72 6F 64 75 63 74 69 6F 6E 2E 0D 0A 20    introduction... 
027C00:  20 20 20 20 20 28 41 29 3A 20 20 20 20 20 20 20         (A):       
027C10:  20 20 20 3A 20 6C 65 63 74 65 75 72 20 41 3A 20       : lecteur A: 
027C20:  61 63 74 69 66 0D 0A 20 20 20 20 20 20 28 42 29    actif..      (B)
027C30:  3A 20 20 20 20 20 20 20 20 20 20 3A 20 6C 65 63    :          : lec
027C40:  74 65 75 72 20 42 3A 20 61 63 74 69 66 0D 0A 0D    teur B: actif...
027C50:  0A 0D 0A 32 29 20 52 65 6D 61 72 71 75 65 73 20    ...2) Remarques 
027C60:  67 65 6E 65 72 61 6C 65 73 2E 0D 0A 0D 0A 20 20    generales.....  
027C70:  20 44 61 6E 73 20 6C 27 65 63 72 61 6E 20 64 65     Dans l'ecran de
027C80:  20 63 6F 6E 66 69 67 75 72 61 74 69 6F 6E 2C 20     configuration, 
027C90:  6C 61 20 66 6F 6E 63 74 69 6F 6E 20 27 54 65 78    la fonction 'Tex
027CA0:  74 20 73 70 65 65 64 27 20 6E 27 65 73 74 20 61    t speed' n'est a
027CB0:  63 74 69 76 65 20 71 75 65 0D 0A 20 20 20 6C 6F    ctive que..   lo
027CC0:  72 73 71 75 65 20 6C 27 61 66 66 69 63 68 61 67    rsque l'affichag
027CD0:  65 20 64 75 20 63 75 72 73 65 75 72 20 6E 27 65    e du curseur n'e
027CE0:  73 74 20 70 61 73 20 73 65 6C 65 63 74 69 6F 6E    st pas selection
027CF0:  6E 65 2E 20 43 65 74 74 65 20 6F 70 74 69 6F 6E    ne. Cette option
027D00:  6C 65 20 20 66 69 63 68 69 65 72 0D 0A 20 20 20    le  fichier..   
027D10:  20 53 59 53 2D 46 52 2E 46 4E 54 2E 0D 0A 0D 0A     SYS-FR.FNT.....
027D20:  49 49 20 47 57 6C 69 6E 6B 2C 20 6C 65 20 67 65    II GWlink, le ge
027D30:  6E 65 72 61 74 65 75 72 20 64 65 20 66 69 63 68    nerateur de fich
027D40:  69 65 72 20 65 78 65 63 75 74 61 62 6C 65 2E 0D    ier executable..
027D50:  0A 0D 0A 43 65 20 70 72 6F 67 72 61 6D 6D 65 20    ...Ce programme 
027D60:  61 20 6C 27 65 73 74 68 65 74 69 71 75 65 20 61    a l'esthetique a
027D70:  75 73 74 65 72 65 20 65 73 74 20 6C 65 20 70 6F    ustere est le po
027D80:  69 6E 74 20 63 65 6E 74 72 61 6C 20 64 65 20 47    int central de G
027D90:  2E 57 2E 20 49 6C 20 70 65 72 6D 65 74 20 64 65    .W. Il permet de
027DA0:  0D 0A 63 68 61 72 67 65 72 20 6C 65 73 20 64 69    ..charger les di
027DB0:  66 66 65 72 65 6E 74 73 20 20 66 69 63 68 69 65    fferents  fichie
027DC0:  72 73 20 63 6F 6D 70 6F 73 61 6E 74 20 75 6E 65    rs composant une
027DD0:  20 70 72 65 73 65 6E 74 61 74 69 6F 6E 2C 20 64     presentation, d
027DE0:  65 20 70 65 72 73 6F 6E 6E 61 6C 69 73 65 72 0D    e personnaliser.
027DF0:  0A 73 6F 6E 20 61 73 70 65 63 74 20 67 72 61 70    .son aspect grap
027E00:  68 69 71 75 65 2C 20 65 74 20 64 65 20 73 61 75    hique, et de sau
027E10:  76 65 67 61 72 64 65 72 20 75 6E 20 66 69 63 68    vegarder un fich
027E20:  69 65 72 20 65 78 65 63 75 74 61 62 6C 65 2E 0D    ier executable..
027E30:  0A 0D 0A 31 29 20 6C 65 73 20 63 6F 6D 6D 61 6E    ...1) les comman
027E40:  64 65 73 20 64 65 20 47 57 6C 69 6E 6B 2E 0D 0A    des de GWlink...
027E50:  0D 0A 20 20 20 20 41 29 20 63 68 6F 69 78 20 64    ..    A) choix d
027E60:  65 73 20 66 69 63 68 69 65 72 73 20 64 65 20 74    es fichiers de t
027E70:  72 61 76 61 69 6C 0D 0A 0D 0A 20 20 20 20 20 20    ravail....      
027E80:  20 4C 65 73 20 63 6F 6D 6D 61 6E 64 65 73 20 63     Les commandes c
027E90:  69 2D 64 65 73 73 6F 75 73 20 70 65 72 6D 65 74    i-dessous permet
027EA0:  74 65 6E 74 20 64 65 20 64 65 66 69 6E 69 72 20    tent de definir 
027EB0:  71 75 65 6C 20 74 79 70 65 20 64 65 20 66 69 63    quel type de fic
027EC0:  68 69 65 72 20 6F 6E 0D 0A 20 20 20 20 20 20 20    hier on..       
027ED0:  73 6F 75 68 61 69 74 65 20 63 68 61 72 67 65 72    souhaite charger
027EE0:  20 65 6E 20 6D 65 6D 6F 69 72 65 2E 20 4C 65 73     en memoire. Les
027EF0:  20 63 6F 6D 6D 61 6E 64 65 73 20 28 44 29 69 72     commandes (D)ir
027F00:  20 20 70 65 72 2D 0D 0A 20 20 20 6D 65 74 20 64      per-..   met d
027F10:  65 20 6D 75 6C 74 69 70 6C 69 65 72 20 70 61 72    e multiplier par
027F20:  20 64 65 75 78 20 6C 61 20 76 69 74 65 73 73 65     deux la vitesse
027F30:  20 64 27 61 66 66 69 63 68 61 67 65 20 64 75 20     d'affichage du 
027F40:  20 74 65 78 74 65 2C 20 63 65 20 71 75 69 20 70     texte, ce qui p
027F50:  65 75 74 0D 0A 20 20 20 65 74 72 65 20 74 72 65    eut..   etre tre
027F60:  73 20 75 74 69 6C 65 20 71 75 61 6E 64 20 76 6F    s utile quand vo
027F70:  75 73 20 75 74 69 6C 69 73 65 7A 20 6C 65 20 6D    us utilisez le m
027F80:  6F 64 65 20 32 20 70 6F 75 72 20 65 63 72 69 72    ode 2 pour ecrir
027F90:  65 20 76 6F 73 20 6D 65 73 73 61 67 65 73 2E 0D    e vos messages..
027FA0:  0A 0D 0A 20 20 20 4C 6F 72 73 71 75 65 20 47 57    ...   Lorsque GW
027FB0:  4C 49 4E 4B 20 66 61 69 74 20 6C 61 20 73 61 75    LINK fait la sau
027FC0:  76 65 67 61 72 64 65 20 64 27 75 6E 65 20 70 72    vegarde d'une pr
027FD0:  65 73 65 6E 74 61 74 69 6F 6E 2C 20 63 65 6C 6C    esentation, cell
027FE0:  65 2D 63 69 20 70 72 65 6E 64 20 73 75 72 0D 0A    e-ci prend sur..
027FF0:  20 20 20 6C 61 20 64 69 73 71 75 65 74 74 65 20       la disquette 
028000:  65 6E 74 72 65 20 31 37 20 65 74 20 33 36 6B 6F    entre 17 et 36ko
028010:  2C 20 65 6E 20 66 6F 6E 63 74 69 6F 6E 20 64 65    , en fonction de
028020:  20 6C 61 20 6C 6F 6E 67 75 65 75 72 20 64 65 20     la longueur de 
028030:  73 6F 6E 2C 20 74 65 78 74 65 2E 0D 0A 20 20 20    son, texte...   
028040:  50 6F 75 72 20 66 61 69 72 65 20 63 68 75 74 65    Pour faire chute
028050:  72 20 66 6F 72 74 65 6D 65 6E 74 20 73 61 20 74    r fortement sa t
028060:  61 69 6C 6C 65 2C 20 75 74 69 6C 69 73 65 72 20    aille, utiliser 
028070:  75 6E 20 63 6F 6D 70 61 63 74 65 75 72 2E 20 4A    un compacteur. J
028080:  65 20 6D 65 20 73 65 72 73 0D 0A 20 20 20 70 65    e me sers..   pe
028090:  72 73 6F 6E 6E 65 6C 6C 65 6D 65 6E 74 20 64 65    rsonnellement de
0280A0:  20 64 65 75 78 20 63 6F 6D 70 61 63 74 65 75 72     deux compacteur
0280B0:  73 20 3A 0D 0A 0D 0A 20 20 20 20 20 20 2A 20 43    s :....      * C
0280C0:  68 65 65 73 65 20 64 65 20 41 6E 74 6F 69 6E 65    heese de Antoine
0280D0:  20 50 69 74 72 6F 75 20 3A 20 72 61 70 69 64 65     Pitrou : rapide
0280E0:  2C 20 65 66 66 69 63 61 63 65 2E 20 41 74 74 65    , efficace. Atte
0280F0:  6E 74 69 6F 6E 20 21 20 4C 61 20 76 65 72 73 69    ntion ! La versi
028100:  20 65 74 20 28 4F 29 70 65 6E 20 73 6F 6E 74 20     et (O)pen sont 
028110:  64 69 72 65 63 2D 0D 0A 20 20 20 20 20 20 20 74    direc-..       t
028120:  65 6D 65 6E 74 20 63 6F 6E 64 69 74 69 6F 6E 6E    ement conditionn
028130:  65 65 73 20 70 61 72 20 6C 61 20 73 65 6C 65 63    ees par la selec
028140:  74 69 6F 6E 20 65 6E 20 63 6F 75 72 73 2E 0D 0A    tion en cours...
028150:  20 0D 0A 20 20 20 20 20 20 20 20 20 20 28 54 29     ..          (T)
028160:  65 78 74 20 66 69 6C 65 20 20 20 3A 20 66 69 63    ext file   : fic
028170:  68 69 65 72 20 54 65 78 74 65 20 43 6F 6D 70 72    hier Texte Compr
028180:  65 73 73 65 20 73 6F 75 73 20 47 57 65 64 69 74    esse sous GWedit
028190:  0D 0A 20 20 20 20 20 20 20 20 20 20 28 46 29 6F    ..          (F)o
0281A0:  6E 74 20 66 69 6C 65 20 20 20 3A 20 2E 2E 2E 0D    nt file   : ....
0281B0:  0A 20 20 20 20 20 20 20 20 20 20 28 4C 29 6F 67    .          (L)og
0281C0:  6F 20 66 69 6C 65 20 20 20 3A 20 2E 2E 2E 0D 0A    o file   : .....
0281D0:  20 20 20 20 20 20 20 20 20 20 28 4D 29 75 73 69              (M)usi
0281E0:  63 20 66 69 6C 65 20 20 3A 20 2E 2E 2E 0D 0A 20    c file  : ..... 
0281F0:  20 20 20 20 20 20 20 20 20 28 31 29 73 74 20 46             (1)st F
028200:  78 20 66 69 6C 65 20 3A 20 66 69 63 68 69 65 72    x file : fichier
028210:  20 64 27 65 66 66 61 63 65 6D 65 6E 74 20 64 65     d'effacement de
028220:  20 6C 27 65 63 72 61 6E 0D 0A 20 20 20 20 20 20     l'ecran..      
028230:  20 20 20 20 28 32 29 6E 64 20 66 78 20 66 69 6C        (2)nd fx fil
028240:  65 20 3A 20 66 69 63 68 69 65 72 20 64 27 61 6E    e : fichier d'an
028250:  69 6D 61 74 69 6F 6E 0D 0A 0D 0A 20 20 20 42 29    imation....   B)
028260:  20 63 6F 6D 6D 61 6E 64 65 73 20 64 69 76 65 72     commandes diver
028270:  73 65 73 0D 0A 0D 0A 20 20 20 20 20 20 28 44 29    ses....      (D)
028280:  69 72 20 20 20 20 20 20 20 20 20 3A 20 63 61 74    ir         : cat
028290:  61 6C 6F 67 75 65 20 64 65 20 6C 61 20 64 69 73    alogue de la dis
0282A0:  71 75 65 74 74 65 20 28 73 65 75 6C 73 20 6C 65    quette (seuls le
0282B0:  73 20 66 69 63 68 69 65 72 73 20 64 75 20 74 79    s fichiers du ty
0282C0:  70 65 0D 0A 20 20 20 20 20 20 20 20 20 20 20 20    pe..            
0282D0:  20 20 20 20 20 20 20 20 20 20 64 65 20 66 69 63              de fic
0282E0:  68 69 65 72 73 20 65 6E 20 63 6F 75 72 73 20 73    hiers en cours s
0282F0:  6F 6E 74 20 61 66 66 69 63 68 65 73 29 2E 0D 0A    ont affiches)...
028300:  6F 6E 0D 0A 20 20 20 20 20 20 20 20 31 2E 30 20    on..        1.0 
028310:  64 65 20 63 65 74 20 20 75 74 69 6C 69 74 61 69    de cet  utilitai
028320:  72 65 20 20 65 6D 70 69 65 74 65 20 73 75 72 20    re  empiete sur 
028330:  20 75 6E 65 20 7A 6F 6E 65 20 64 65 20 6C 61 20     une zone de la 
028340:  52 41 4D 20 72 65 73 65 72 76 65 65 20 61 75 0D    RAM reservee au.
028350:  0A 20 20 20 20 20 20 20 20 73 79 73 74 65 6D 65    .        systeme
028360:  20 20 28 3D 20 70 6C 61 6E 74 61 67 65 20 61 76      (= plantage av
028370:  65 63 20 6C 6F 61 64 65 72 20 42 61 73 69 63 29    ec loader Basic)
028380:  2E 20 4C 65 73 20 6F 70 74 69 6F 6E 73 20 64 65    . Les options de
028390:  20 70 61 72 61 6D 65 74 72 61 67 65 0D 0A 20 20     parametrage..  
0283A0:  20 20 20 20 20 20 64 65 20 6C 61 20 76 65 72 73          de la vers
0283B0:  69 6F 6E 20 31 2E 31 20 70 65 72 6D 65 74 74 65    ion 1.1 permette
0283C0:  6E 74 20 64 27 6F 75 62 6C 69 65 72 20 63 65 20    nt d'oublier ce 
0283D0:  64 65 73 61 67 72 65 6D 65 6E 74 2E 20 0D 0A 0D    desagrement. ...
0283E0:  0A 20 20 20 20 20 20 2A 20 43 72 75 6E 63 68 65    .      * Crunche
0283F0:  72 20 64 65 20 43 72 6F 77 6E 20 6F 66 20 42 65    r de Crown of Be
028400:  6E 67 21 20 3A 20 63 6F 6D 70 61 63 74 65 75 72    ng! : compacteur
028410:  20 74 72 65 73 20 6C 65 6E 74 20 6D 61 69 73 20     tres lent mais 
028420:  65 66 66 69 63 61 63 65 2E 20 4C 75 69 0D 0A 20    efficace. Lui.. 
028430:  20 20 20 20 20 20 20 70 65 72 6D 65 74 20 64 65           permet de
028440:  20 63 72 65 65 72 20 64 65 73 20 69 6E 74 72 6F     creer des intro
028450:  73 20 66 6F 6E 63 74 69 6F 6E 6E 61 6E 74 20 61    s fonctionnant a
028460:  20 70 61 72 74 69 72 20 64 27 75 6E 20 63 68 61     partir d'un cha
028470:  72 67 65 75 72 20 42 61 73 69 63 0D 0A 20 20 20    rgeur Basic..   
028480:  20 20 20 20 20 65 74 20 6C 75 69 20 27 72 65 6E         et lui 'ren
028490:  64 61 6E 74 20 6C 61 20 6D 61 69 6E 27 2E 0D 0A    dant la main'...
0284A0:  0D 0A 20 20 20 53 75 69 76 61 6E 74 20 20 6C 61    ..   Suivant  la
0284B0:  20 74 61 69 6C 6C 65 20 64 65 73 20 20 64 69 66     taille des  dif
0284C0:  66 65 72 65 6E 74 73 20 20 65 6C 65 6D 65 6E 74    ferents  element
0284D0:  73 20 63 6F 6D 70 6F 73 61 6E 74 20 76 6F 74 72    s composant votr
0284E0:  65 20 70 72 65 73 65 6E 74 61 74 69 6F 6E 2C 0D    e presentation,.
0284F0:  0A 20 20 20 76 6F 75 73 20 6F 62 74 69 65 6E 64    .   vous obtiend
028500:  20 20 20 20 20 20 28 4F 29 70 65 6E 20 66 69 6C          (O)pen fil
028510:  65 20 20 20 3A 20 63 68 61 72 67 65 6D 65 6E 74    e   : chargement
028520:  20 64 27 75 6E 20 66 69 63 68 69 65 72 20 70 61     d'un fichier pa
028530:  72 61 6D 65 74 72 65 2E 20 50 6F 75 72 20 63 68    rametre. Pour ch
028540:  61 71 75 65 20 74 79 70 65 20 64 65 0D 0A 20 20    aque type de..  
028550:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
028560:  20 20 20 20 66 69 63 68 69 65 72 2C 20 75 6E 20        fichier, un 
028570:  63 6F 6E 74 72 6F 6C 65 20 64 65 20 76 61 6C 69    controle de vali
028580:  64 69 74 65 20 65 73 74 20 65 66 66 65 63 74 75    dite est effectu
028590:  65 20 28 61 64 72 65 73 73 65 0D 0A 20 20 20 20    e (adresse..    
0285A0:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
0285B0:  20 20 64 65 20 64 65 70 61 72 74 20 64 75 20 66      de depart du f
0285C0:  69 63 68 69 65 72 2C 20 6C 6F 6E 67 75 65 75 72    ichier, longueur
0285D0:  2C 20 65 74 63 2E 2E 20 29 2E 0D 0A 20 20 20 20    , etc.. )...    
0285E0:  20 20 28 53 29 61 76 65 20 69 6E 74 72 6F 20 20      (S)ave intro  
0285F0:  3A 20 73 61 75 76 65 67 61 72 64 65 20 64 65 20    : sauvegarde de 
028600:  6C 61 20 70 72 65 73 65 6E 74 61 74 69 6F 6E 2E    la presentation.
028610:  20 45 6C 6C 65 20 6E 27 65 73 74 20 70 6F 73 73     Elle n'est poss
028620:  69 62 6C 65 20 71 75 65 0D 0A 20 20 20 20 20 20    ible que..      
028630:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
028640:  71 75 61 6E 64 20 74 6F 75 74 20 6C 65 73 20 66    quand tout les f
028650:  69 63 68 69 65 72 73 20 70 61 72 61 6D 65 74 72    ichiers parametr
028660:  65 73 20 63 6F 6D 70 6F 73 61 6E 74 20 75 6E 65    es composant une
028670:  20 70 72 65 2D 0D 0A 20 20 20 20 20 20 20 20 20     pre-..         
028680:  20 20 20 20 20 20 20 20 20 20 20 20 20 73 65 6E                 sen
028690:  74 61 74 69 6F 6E 20 73 6F 6E 74 20 63 68 61 72    tation sont char
0286A0:  67 65 73 20 65 6E 20 6D 65 6D 6F 69 72 65 2E 0D    ges en memoire..
0286B0:  0A 20 20 20 20 20 20 28 43 29 6F 6E 66 69 67 20    .      (C)onfig 
0286C0:  20 20 20 20 20 3A 20 63 6F 6E 66 69 67 75 72 61         : configura
0286D0:  74 69 6F 6E 20 64 65 20 6C 61 20 70 72 65 73 65    tion de la prese
0286E0:  6E 74 61 74 69 6F 6E 2E 20 6C 65 73 20 74 6F 75    ntation. les tou
0286F0:  63 68 65 73 20 28 68 61 75 74 29 20 65 74 0D 0A    ches (haut) et..
028700:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
028710:  22 00 01 00 02 09 51 E5 22 00 C1 02 00 00 00 02    ".....Q.".......
028720:  22 00 C6 02 00 00 00 02 22 00 C2 02 00 00 00 02    ".......".......
028730:  22 00 C7 02 00 00 00 02 22 00 C3 02 00 00 00 02    ".......".......
028740:  22 00 C8 02 00 00 00 02 22 00 C4 02 00 00 00 02    ".......".......
028750:  22 00 C9 02 00 00 00 02 22 00 C5 02 00 00 00 02    ".......".......
028760:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
028770:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
028780:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
028790:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0287A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0287B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0287C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0287D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0287E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
0287F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
028800:  72 65 7A 20 75 6E 20 66 69 63 68 69 65 72 20 64    rez un fichier d
028810:  6F 6E 74 20 6C 61 20 6C 6F 6E 67 75 65 75 72 20    ont la longueur 
028820:  76 61 72 69 65 20 65 6E 74 72 65 20 38 6B 6F 20    varie entre 8ko 
028830:  65 74 20 31 32 6B 6F 2E 0D 0A 20 20 20 4C 6F 72    et 12ko...   Lor
028840:  73 71 75 65 20 76 6F 75 73 20 73 61 75 76 65 67    sque vous sauveg
028850:  61 72 64 65 7A 20 20 75 6E 65 20 20 70 72 65 73    ardez  une  pres
028860:  65 6E 74 61 74 69 6F 6E 20 20 47 68 6F 75 6C 27    entation  Ghoul'
028870:  73 20 57 72 69 74 65 72 2C 20 6C 65 20 70 72 6F    s Writer, le pro
028880:  67 72 61 6D 6D 65 0D 0A 20 20 20 67 65 6E 65 72    gramme..   gener
028890:  65 20 61 75 72 61 20 6C 65 73 20 63 61 72 61 63    e aura les carac
0288A0:  74 65 72 69 73 74 69 71 75 65 73 20 73 75 69 76    teristiques suiv
0288B0:  61 6E 74 65 73 20 3A 0D 0A 0D 0A 20 20 20 20 20    antes :....     
0288C0:  20 20 20 20 20 20 20 20 20 20 20 2A 20 41 64 72               * Adr
0288D0:  65 73 73 65 20 64 27 69 6D 70 6C 61 6E 74 61 74    esse d'implantat
0288E0:  69 6F 6E 20 3A 20 76 61 72 69 61 62 6C 65 0D 0A    ion : variable..
0288F0:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
028900:  2A 20 41 64 72 65 73 73 65 20 64 27 65 78 65 63    * Adresse d'exec
028910:  75 74 69 6F 6E 20 20 20 20 3A 20 26 39 30 30 30    ution    : &9000
028920:  0D 0A 20 20 20 20 20 20 20 20 20 20 20 20 20 20    ..              
028930:  20 20 2A 20 4C 6F 6E 75 67 75 65 75 72 20 20 20      * Lonugueur   
028940:  20 20 20 20 20 20 20 20 20 20 20 3A 20 76 61 72               : var
028950:  69 61 62 6C 65 0D 0A 0D 0A 20 20 20 43 65 74 74    iable....   Cett
028960:  65 20 70 72 65 73 65 6E 74 61 74 69 6F 6E 20 70    e presentation p
028970:  65 75 74 20 70 61 72 66 61 69 74 65 6D 65 6E 74    eut parfaitement
028980:  20 65 74 72 65 20 63 68 61 72 67 65 65 20 20 65     etre chargee  e
028990:  74 20 65 78 65 63 75 74 65 65 20 20 61 20 70 61    t executee  a pa
0289A0:  72 74 69 72 0D 0A 20 20 20 64 27 75 6E 20 6C 6F    rtir..   d'un lo
0289B0:  61 64 65 72 20 42 61 73 69 63 2C 20 20 63 65 20    ader Basic,  ce 
0289C0:  71 75 69 20 70 65 72 6D 65 74 20 64 65 20 6C 27    qui permet de l'
0289D0:  75 74 69 6C 69 73 65 72 20 66 61 63 69 6C 65 6D    utiliser facilem
0289E0:  65 6E 74 20 20 64 61 6E 73 20 75 6E 20 66 61 6E    ent  dans un fan
0289F0:  2D 0D 0A 20 20 20 7A 69 6E 65 2E 0D 0A 0D 0A 20    -..   zine..... 
028A00:  53 54 20 6E 65 20 72 65 6C 6F 67 65 20 70 61 73    ST ne reloge pas
028A10:  20 6C 65 73 20 6D 75 73 69 71 75 65 73 20 75 74     les musiques ut
028A20:  69 6C 69 73 61 6E 74 20 20 6C 65 20 6D 6F 64 75    ilisant  le modu
028A30:  6C 65 20 53 54 2D 31 32 38 2E 20 43 65 0D 0A 66    le ST-128. Ce..f
028A40:  6F 72 6D 61 74 20 64 65 20 66 69 63 68 69 65 72    ormat de fichier
028A50:  20 64 69 66 66 65 72 65 6E 74 20 64 75 20 66 6F     different du fo
028A60:  72 6D 61 74 20 53 2E 54 2C 20 6E 65 20 73 65 20    rmat S.T, ne se 
028A70:  72 65 74 72 6F 75 76 65 20 71 75 65 20 64 61 6E    retrouve que dan
028A80:  73 20 6C 65 73 20 6D 75 73 69 2D 0D 0A 71 75 65    s les musi-..que
028A90:  73 20 6C 65 73 20 70 6C 75 73 20 72 65 63 65 6E    s les plus recen
028AA0:  74 65 73 20 64 65 20 4B 61 6E 67 61 72 6F 6F 2C    tes de Kangaroo,
028AB0:  20 63 65 6C 65 62 72 65 20 27 63 6F 6D 70 6F 73     celebre 'compos
028AC0:  69 74 65 75 72 27 20 73 75 72 20 43 50 43 2E 0D    iteur' sur CPC..
028AD0:  0A 0D 0A 41 74 74 65 6E 74 69 6F 6E 20 21 20 43    ...Attention ! C
028AE0:  65 20 70 72 6F 67 72 61 6D 6D 65 20 61 79 61 6E    e programme ayan
028AF0:  74 20 65 74 65 20 72 65 61 6C 69 73 65 20 73 61    t ete realise sa
028B00:  6E 73 20 71 75 65 20 20 6A 65 20 63 6F 6E 6E 61    ns que  je conna
028B10:  69 73 73 65 20 74 6F 75 74 65 73 20 6C 65 73 0D    isse toutes les.
028B20:  0A 73 75 62 74 69 6C 69 74 65 73 20 64 75 20 66    .subtilites du f
028B30:  6F 72 6D 61 74 20 53 6F 75 6E 64 74 72 61 6B 6B    ormat Soundtrakk
028B40:  65 72 2C 20 63 65 72 74 61 69 6E 65 73 20 6D 75    er, certaines mu
028B50:  73 69 71 75 65 73 20 70 6F 75 72 72 6F 6E 74 20    siques pourront 
028B60:  20 6E 65 20 70 61 73 20 20 65 74 72 65 0D 0A 62     ne pas  etre..b
028B70:  69 65 6E 20 72 65 6C 6F 67 65 65 73 2E 20 20 4A    ien relogees.  J
028B80:  27 61 69 20 66 61 69 74 20 64 65 73 20 65 73 73    'ai fait des ess
028B90:  61 69 73 20 73 75 72 20 20 75 6E 65 20 62 6F 6E    ais sur  une bon
028BA0:  6E 65 20 71 75 69 6E 7A 61 69 6E 65 20 64 65 20    ne quinzaine de 
028BB0:  74 69 74 72 65 73 20 70 72 6F 2D 0D 0A 76 65 6E    titres pro-..ven
028BC0:  61 6E 74 20 64 65 20 64 65 6D 6F 73 20 73 61 6E    ant de demos san
028BD0:  73 20 70 72 6F 62 6C 65 6D 65 2E 0D 0A 0D 0A 0D    s probleme......
028BE0:  0A 56 49 49 20 4C 65 20 66 6F 72 6D 61 74 20 64    .VII Le format d
028BF0:  65 73 20 66 69 63 68 69 65 72 73 20 70 61 72 61    es fichiers para
028C00:  20 20 56 6F 75 73 20 70 6F 75 76 65 7A 20 6C 69      Vous pouvez li
028C10:  6D 69 74 65 72 20 6C 61 20 74 61 69 6C 6C 65 20    miter la taille 
028C20:  64 27 75 6E 65 20 70 72 65 73 65 6E 74 61 74 69    d'une presentati
028C30:  6F 6E 20 20 65 6E 20 6E 65 20 63 68 61 72 67 65    on  en ne charge
028C40:  61 6E 74 20 70 61 73 20 64 65 0D 0A 20 20 20 6D    ant pas de..   m
028C50:  75 73 69 71 75 65 2C 20 64 65 20 6C 6F 67 6F 20    usique, de logo 
028C60:  6F 75 20 64 27 61 6E 69 6D 61 74 69 6F 6E 2E 20    ou d'animation. 
028C70:  50 6F 75 72 20 63 65 63 69 2C 20 69 6C 20 65 78    Pour ceci, il ex
028C80:  69 73 74 65 20 74 72 6F 69 73 20 66 69 63 68 69    iste trois fichi
028C90:  65 72 73 20 73 75 72 0D 0A 20 20 20 6C 61 20 64    ers sur..   la d
028CA0:  69 73 71 75 65 74 74 65 20 64 65 20 47 2E 57 20    isquette de G.W 
028CB0:  3A 0D 0A 0D 0A 20 20 20 20 20 20 20 20 20 20 20    :....           
028CC0:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 4E 4F                  NO
028CD0:  2D 4D 55 53 49 43 2E 4D 55 53 0D 0A 20 20 20 20    -MUSIC.MUS..    
028CE0:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
028CF0:  20 20 20 20 20 4E 4F 2D 4C 4F 47 4F 20 2E 47 57         NO-LOGO .GW
028D00:  4C 0D 0A 20 20 20 20 20 20 20 20 20 20 20 20 20    L..             
028D10:  20 20 20 20 20 20 20 20 20 20 20 20 4E 4F 2D 46                NO-F
028D20:  58 32 20 20 2E 47 57 58 0D 0A 20 20 20 20 20 20    X2  .GWX..      
028D30:  20 20 0D 0A 20 20 20 4C 65 75 72 73 20 6E 6F 6D      ..   Leurs nom
028D40:  73 20 73 6F 6E 74 20 61 73 73 65 7A 20 65 78 70    s sont assez exp
028D50:  6C 69 63 69 74 65 73 20 21 0D 0A 0D 0A 0D 0A 49    licites !......I
028D60:  56 20 47 57 4C 4F 47 4F 2C 20 70 72 6F 67 72 61    V GWLOGO, progra
028D70:  6D 6D 65 20 64 65 20 63 72 65 61 74 69 6F 6E 20    mme de creation 
028D80:  64 65 20 6C 6F 67 6F 0D 0A 0D 0A 43 65 20 70 72    de logo....Ce pr
028D90:  6F 67 72 61 6D 6D 65 2C 20 20 65 63 72 69 74 20    ogramme,  ecrit 
028DA0:  65 6E 20 6D 61 6A 6F 72 69 74 65 20 65 6E 20 42    en majorite en B
028DB0:  61 73 69 63 2C 20 65 73 74 20 74 72 65 73 20 73    asic, est tres s
028DC0:  69 6D 70 6C 65 20 64 27 75 74 69 6C 69 73 61 74    imple d'utilisat
028DD0:  69 6F 6E 2E 20 20 49 6C 0D 0A 70 65 72 6D 65 74    ion.  Il..permet
028DE0:  20 64 65 20 63 72 65 65 72 20 20 75 6E 20 66 69     de creer  un fi
028DF0:  63 68 69 65 72 20 4C 6F 67 6F 20 75 74 69 6C 69    chier Logo utili
028E00:  6D 65 74 72 65 73 20 64 65 20 47 68 6F 75 6C 27    metres de Ghoul'
028E10:  73 20 57 72 69 74 65 72 0D 0A 0D 0A 43 65 74 74    s Writer....Cett
028E20:  65 20 73 65 63 74 69 6F 6E 20 65 73 74 20 72 65    e section est re
028E30:  73 65 72 76 65 65 20 61 75 78 20 75 74 69 6C 69    servee aux utili
028E40:  73 61 74 65 75 72 73 20 6E 65 20 73 6F 75 68 61    sateurs ne souha
028E50:  69 74 61 6E 74 20 70 61 73 20 73 65 20 63 6F 6E    itant pas se con
028E60:  74 65 6E 74 65 72 20 64 65 73 0D 0A 66 69 63 68    tenter des..fich
028E70:  69 65 72 73 20 70 61 72 61 6D 65 74 72 65 73 20    iers parametres 
028E80:  6C 69 76 72 65 73 20 61 76 65 63 20 47 68 6F 75    livres avec Ghou
028E90:  6C 27 73 20 57 72 69 74 65 72 2C 20 65 74 20 75    l's Writer, et u
028EA0:  74 69 6C 69 73 65 72 20 6C 65 75 72 73 20 70 72    tiliser leurs pr
028EB0:  6F 70 72 65 73 20 6F 65 75 2D 0D 0A 76 72 65 73    opres oeu-..vres
028EC0:  2E 0D 0A 0D 0A 46 69 63 68 69 65 72 20 2E 4D 55    .....Fichier .MU
028ED0:  53 20 3A 20 6D 75 73 69 71 75 65 0D 0A 0D 0A 20    S : musique.... 
028EE0:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 43 65                  Ce
028EF0:  20 66 69 63 68 69 65 72 20 64 6F 69 74 20 61 76     fichier doit av
028F00:  6F 69 72 20 65 74 65 20 63 72 65 65 20 61 76 65    oir ete cree ave
028F10:  63 20 6C 65 20 53 6F 75 6E 64 74 72 61 6B 6B 65    c le Soundtrakke
028F20:  72 20 64 65 20 42 53 43 20 6F 75 0D 0A 20 20 20    r de BSC ou..   
028F30:  20 20 20 20 20 20 20 20 20 20 20 20 75 6E 20 61                un a
028F40:  75 74 72 65 20 6C 6F 67 69 63 69 65 6C 20 61 79    utre logiciel ay
028F50:  61 6E 74 20 20 75 6E 20 27 70 6C 61 79 65 72 27    ant  un 'player'
028F60:  20 73 75 66 66 69 73 61 6D 6D 65 6E 74 20 72 61     suffisamment ra
028F70:  70 69 64 65 2E 20 20 49 6C 0D 0A 20 20 20 20 20    pide.  Il..     
028F80:  20 20 20 20 20 20 20 20 20 20 64 6F 69 74 20 64              doit d
028F90:  65 20 70 6C 75 73 20 73 65 20 63 6F 6E 66 6F 72    e plus se confor
028FA0:  6D 65 72 20 61 75 78 20 63 72 69 74 65 72 65 73    mer aux criteres
028FB0:  20 73 75 69 76 61 6E 74 73 20 3A 0D 0A 0D 0A 20     suivants :.... 
028FC0:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 2A 20                  * 
028FD0:  41 64 72 65 73 73 65 20 64 27 69 6D 70 6C 61 6E    Adresse d'implan
028FE0:  74 61 74 69 6F 6E 20 20 20 3A 20 26 36 30 30 30    tation   : &6000
028FF0:  0D 0A 20 20 20 20 20 20 20 20 20 20 20 20 20 20    ..              
029000:  73 61 62 6C 65 20 20 70 61 72 20 47 57 4C 49 4E    sable  par GWLIN
029010:  4B 20 61 20 70 61 72 74 69 72 20 64 27 75 6E 20    K a partir d'un 
029020:  66 69 63 68 69 65 72 0D 0A 65 63 72 61 6E 20 73    fichier..ecran s
029030:  74 61 6E 64 61 72 64 20 31 37 6B 6F 2E 20 47 57    tandard 17ko. GW
029040:  6C 6F 67 6F 20 76 6F 75 73 20 64 65 6D 61 6E 64    logo vous demand
029050:  65 20 6A 75 73 74 65 20 6C 65 20 6E 6F 6D 20 64    e juste le nom d
029060:  75 20 66 69 63 68 69 65 72 20 63 72 61 6E 20 61    u fichier cran a
029070:  20 63 68 61 72 2D 0D 0A 67 65 72 2C 20 70 75 69     char-..ger, pui
029080:  73 20 20 6C 65 20 6E 6F 6D 20 20 64 75 20 66 69    s  le nom  du fi
029090:  63 68 69 65 72 20 4C 6F 67 6F 2E 20 20 4C 65 20    chier Logo.  Le 
0290A0:  64 65 73 73 69 6E 20 73 75 72 20 20 6C 65 20 66    dessin sur  le f
0290B0:  69 63 68 69 65 72 20 65 63 72 61 6E 20 20 64 6F    ichier ecran  do
0290C0:  69 74 20 73 65 0D 0A 74 72 6F 75 76 65 72 20 65    it se..trouver e
0290D0:  6E 20 68 61 75 74 20 61 20 67 61 75 63 68 65 20    n haut a gauche 
0290E0:  64 65 20 6C 27 65 63 72 61 6E 2C 20 65 74 20 65    de l'ecran, et e
0290F0:  74 72 65 20 63 65 6E 74 72 65 20 73 75 72 20 6C    tre centre sur l
029100:  61 20 68 61 75 74 65 75 72 20 65 74 20 6C 61 20    a hauteur et la 
029110:  6C 61 72 2D 0D 0A 67 65 75 72 20 73 75 69 76 61    lar-..geur suiva
029120:  6E 74 65 73 20 3A 0D 0A 0D 0A 20 20 20 20 20 20    ntes :....      
029130:  20 20 20 20 20 20 20 20 20 20 2D 20 48 61 75 74              - Haut
029140:  65 75 72 20 3A 20 36 20 63 61 72 61 63 74 65 72    eur : 6 caracter
029150:  65 73 20 20 28 20 3D 20 34 38 20 6C 69 67 6E 65    es  ( = 48 ligne
029160:  73 20 76 69 64 65 6F 29 0D 0A 20 20 20 20 20 20    s video)..      
029170:  20 20 20 20 20 20 20 20 20 20 2D 20 4C 61 72 67              - Larg
029180:  65 75 72 20 3A 20 33 37 20 63 61 72 61 63 74 65    eur : 37 caracte
029190:  72 65 73 20 28 20 3D 20 37 34 20 6F 63 74 65 74    res ( = 74 octet
0291A0:  73 29 0D 0A 0D 0A 41 66 69 6E 20 64 65 20 76 6F    s)....Afin de vo
0291B0:  75 73 20 65 76 69 74 65 72 20 75 6E 65 20 63 72    us eviter une cr
0291C0:  69 73 65 20 64 65 20 6E 65 72 66 73 20 6C 6F 72    ise de nerfs lor
0291D0:  73 20 64 75 20 63 65 6E 74 72 61 67 65 20 64 65    s du centrage de
0291E0:  20 76 6F 73 20 73 75 70 65 72 62 65 73 20 6C 6F     vos superbes lo
0291F0:  67 6F 73 2C 0D 0A 6C 61 6E 63 65 7A 20 6C 65 20    gos,..lancez le 
029200:  20 2A 20 41 64 72 65 73 73 65 20 64 27 69 6E 69     * Adresse d'ini
029210:  74 69 61 6C 69 73 61 74 69 6F 6E 20 3A 20 26 36    tialisation : &6
029220:  30 30 30 0D 0A 20 20 20 20 20 20 20 20 20 20 20    000..           
029230:  20 20 20 20 2A 20 41 64 72 65 73 73 65 20 64 27        * Adresse d'
029240:  65 78 65 63 75 74 69 6F 6E 20 20 20 20 20 20 3A    execution      :
029250:  20 26 36 30 30 33 0D 0A 20 20 20 20 20 20 20 20     &6003..        
029260:  20 20 20 20 20 20 20 2A 20 4C 6F 6E 67 75 65 75           * Longueu
029270:  72 20 6D 61 78 69 6D 61 6C 65 20 20 20 20 20 20    r maximale      
029280:  20 20 3A 20 26 31 44 30 30 0D 0A 0D 0A 46 69 63      : &1D00....Fic
029290:  68 69 65 72 20 2E 46 4E 54 20 3A 20 66 6F 6E 74    hier .FNT : font
0292A0:  65 20 63 6F 6D 70 61 74 69 62 6C 65 20 54 41 4F    e compatible TAO
0292B0:  43 50 20 61 72 74 20 53 74 75 64 69 6F 0D 0A 0D    CP art Studio...
0292C0:  0A 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20    .               
0292D0:  44 61 6E 73 20 63 65 20 66 6F 72 6D 61 74 20 64    Dans ce format d
0292E0:  65 20 66 6F 6E 74 65 20 2C 20 75 6E 20 63 61 72    e fonte , un car
0292F0:  61 63 74 65 72 65 20 65 73 74 20 63 6F 64 65 20    actere est code 
029300:  20 73 75 72 20 38 20 6F 63 74 65 74 73 2C 0D 0A     sur 8 octets,..
029310:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 6F                   o
029320:  72 67 61 6E 69 73 65 73 20 64 75 20 27 68 61 75    rganises du 'hau
029330:  74 27 20 76 65 72 73 20 6C 65 20 27 62 61 73 27    t' vers le 'bas'
029340:  20 28 63 6F 6D 6D 65 20 75 6E 65 20 66 6F 6E 74     (comme une font
029350:  65 20 65 6E 20 6D 6F 64 65 20 32 29 2E 0D 0A 20    e en mode 2)... 
029360:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 43 68                  Ch
029370:  61 71 75 65 20 66 69 63 68 69 65 72 20 2E 46 4E    aque fichier .FN
029380:  54 20 63 6F 6E 74 69 65 6E 74 20 6C 65 73 20 72    T contient les r
029390:  65 64 65 66 69 6E 69 74 69 6F 6E 73 20 20 64 65    edefinitions  de
0293A0:  73 20 63 61 72 61 63 74 65 72 65 73 0D 0A 20 20    s caracteres..  
0293B0:  20 20 20 20 20 20 20 20 20 20 20 20 20 41 53 43                 ASC
0293C0:  49 49 20 33 32 20 61 20 31 32 37 2E 0D 0A 0D 0A    II 32 a 127.....
0293D0:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 2A                   *
0293E0:  20 4C 6F 6E 67 75 65 75 72 20 64 27 75 6E 20 66     Longueur d'un f
0293F0:  69 63 68 69 65 72 20 2E 46 4E 54 20 3A 20 26 33    ichier .FNT : &3
029400:  66 69 63 68 69 65 72 20 2D 47 57 46 52 41 4D 45    fichier -GWFRAME
029410:  2E 42 41 53 2E 20 43 65 20 70 72 6F 67 72 61 6D    .BAS. Ce program
029420:  6D 65 20 76 61 20 63 72 65 65 72 20 75 6E 20 66    me va creer un f
029430:  69 63 68 69 65 72 20 65 63 72 61 6E 20 31 37 6B    ichier ecran 17k
029440:  6F 20 61 2D 0D 0A 76 65 63 20 75 6E 20 63 61 64    o a-..vec un cad
029450:  72 65 2E 20 20 4C 61 20 7A 6F 6E 65 20 61 20 6C    re.  La zone a l
029460:  27 69 6E 74 65 72 69 65 75 72 20 64 65 20 63 65    'interieur de ce
029470:  20 63 61 64 72 65 20 20 63 6F 72 72 65 73 70 6F     cadre  correspo
029480:  6E 64 20 61 20 6C 61 20 73 75 72 66 61 63 65 20    nd a la surface 
029490:  64 27 75 6E 0D 0A 6C 6F 67 6F 2E 0D 0A 50 6F 75    d'un..logo...Pou
0294A0:  72 20 71 75 65 20 20 6C 65 73 20 75 74 69 6C 69    r que  les utili
0294B0:  73 61 74 65 75 72 73 20 6E 6F 6E 20 66 65 72 75    sateurs non feru
0294C0:  73 20 64 65 20 67 72 61 70 68 69 73 6D 65 20 20    s de graphisme  
0294D0:  70 75 69 73 73 65 6E 74 20 71 75 61 6E 64 20 6D    puissent quand m
0294E0:  65 6D 65 20 20 65 67 61 79 65 72 0D 0A 6C 65 75    eme  egayer..leu
0294F0:  72 73 20 70 72 65 73 65 6E 74 61 74 69 6F 6E 73    rs presentations
029500:  2C 20 47 2E 57 20 63 6F 6E 74 69 65 6E 74 20 75    , G.W contient u
029510:  6E 65 20 70 65 74 69 74 65 20 27 62 69 62 6C 69    ne petite 'bibli
029520:  6F 74 68 65 71 75 65 27 20 64 65 20 64 65 73 73    otheque' de dess
029530:  69 6E 73 20 65 6E 20 6D 6F 64 65 0D 0A 31 2C 20    ins en mode..1, 
029540:  63 6F 6E 74 65 6E 75 65 20 64 61 6E 73 20 6C 65    contenue dans le
029550:  20 66 69 63 68 69 65 72 20 65 63 72 61 6E 20 47     fichier ecran G
029560:  57 2D 43 4C 49 50 2E 53 43 52 2E 0D 0A 0D 0A 0D    W-CLIP.SCR......
029570:  0A 56 20 47 57 46 4F 4E 54 2C 20 70 72 6F 67 72    .V GWFONT, progr
029580:  61 6D 6D 65 20 64 65 20 72 65 63 75 70 65 72 61    amme de recupera
029590:  74 69 6F 6E 20 64 65 20 66 6F 6E 74 65 73 20 42    tion de fontes B
0295A0:  61 73 69 63 2E 0D 0A 0D 0A 43 65 20 74 6F 75 74    asic.....Ce tout
0295B0:  20 70 65 74 69 74 20 70 72 6F 67 72 61 6D 6D 65     petit programme
0295C0:  20 42 61 73 69 63 20 70 65 72 6D 65 74 20 64 65     Basic permet de
0295D0:  20 63 6F 6E 76 65 72 74 69 72 20 75 6E 65 20 66     convertir une f
0295E0:  6F 6E 74 65 20 64 65 20 63 61 72 61 63 74 65 72    onte de caracter
0295F0:  65 73 20 64 65 0D 0A 6C 61 20 6D 65 6D 6F 69 72    es de..la memoir
029600:  30 30 0D 0A 0D 0A 46 69 63 68 69 65 72 20 2E 47    00....Fichier .G
029610:  57 4C 20 3A 20 6C 6F 67 6F 0D 0A 0D 0A 20 20 20    WL : logo....   
029620:  20 20 20 20 20 20 20 20 20 20 20 20 46 69 63 68                Fich
029630:  69 65 72 20 63 72 65 65 20 61 76 65 63 20 6C 65    ier cree avec le
029640:  20 70 72 6F 67 72 61 6D 6D 65 20 2D 47 57 4C 4F     programme -GWLO
029650:  47 4F 2E 42 41 53 2E 20 49 6C 20 73 27 61 67 69    GO.BAS. Il s'agi
029660:  74 20 64 27 75 6E 0D 0A 20 20 20 20 20 20 20 20    t d'un..        
029670:  20 20 20 20 20 20 20 73 69 6D 70 6C 65 20 73 70           simple sp
029680:  72 69 74 65 2E 0D 0A 0D 0A 20 20 20 20 20 20 20    rite.....       
029690:  20 20 20 20 20 20 20 20 2A 20 41 64 72 65 73 73            * Adress
0296A0:  65 20 64 65 20 63 68 61 72 67 65 6D 65 6E 74 20    e de chargement 
0296B0:  3A 20 26 37 45 30 30 0D 0A 20 20 20 20 20 20 20    : &7E00..       
0296C0:  20 20 20 20 20 20 20 20 2A 20 4C 6F 6E 67 75 65            * Longue
0296D0:  75 72 20 20 20 20 20 20 20 20 20 20 20 20 20 20    ur              
0296E0:  3A 20 26 30 44 45 30 0D 0A 0D 0A 46 69 63 68 69    : &0DE0....Fichi
0296F0:  65 72 20 2E 47 57 45 20 3A 20 74 61 62 6C 65 20    er .GWE : table 
029700:  64 27 65 66 66 61 63 65 6D 65 6E 74 20 64 65 20    d'effacement de 
029710:  6C 27 65 63 72 61 6E 20 74 65 78 74 65 2E 0D 0A    l'ecran texte...
029720:  0D 0A 20 20 20 20 20 20 20 20 20 20 20 20 20 20    ..              
029730:  20 43 65 20 66 69 63 68 69 65 72 20 73 65 20 63     Ce fichier se c
029740:  6F 6D 70 6F 73 65 20 64 65 20 31 34 35 20 6F 63    ompose de 145 oc
029750:  74 65 74 73 2E 20 43 68 61 71 75 65 20 6F 63 74    tets. Chaque oct
029760:  65 74 20 72 65 70 72 65 73 65 6E 74 65 0D 0A 20    et represente.. 
029770:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 75 6E                  un
029780:  65 20 64 65 73 20 31 34 34 20 6C 69 67 6E 65 73    e des 144 lignes
029790:  20 64 65 20 6C 27 65 63 72 61 6E 20 74 65 78 74     de l'ecran text
0297A0:  65 2E 20 4C 65 20 64 65 72 6E 69 65 72 20 6F 63    e. Le dernier oc
0297B0:  74 65 74 20 65 73 74 20 75 6E 0D 0A 20 20 20 20    tet est un..    
0297C0:  20 20 20 20 20 20 20 20 20 20 20 63 6F 64 65 20               code 
0297D0:  64 65 20 66 69 6E 2E 20 53 61 20 76 61 6C 65 75    de fin. Sa valeu
0297E0:  72 20 65 73 74 20 32 35 35 2E 20 20 43 65 20 66    r est 255.  Ce f
0297F0:  6F 72 6D 61 74 20 70 65 72 6D 65 74 20 64 65 20    ormat permet de 
029800:  65 20 20 64 75 20 43 50 43 20 65 6E 20 75 6E 20    e  du CPC en un 
029810:  66 69 63 68 69 65 72 20 2E 46 4E 54 20 20 63 6F    fichier .FNT  co
029820:  6D 70 61 74 69 62 6C 65 20 4F 43 50 20 41 72 74    mpatible OCP Art
029830:  20 53 74 75 64 69 6F 2E 20 20 4C 27 6F 6E 20 70     Studio.  L'on p
029840:  65 75 74 0D 0A 61 69 6E 73 69 20 75 74 69 6C 69    eut..ainsi utili
029850:  73 65 72 20 20 64 65 73 20 66 6F 6E 74 65 73 20    ser  des fontes 
029860:  72 65 64 65 66 69 6E 69 65 73 20 70 61 72 20 64    redefinies par d
029870:  65 73 20 63 6F 6D 6D 61 6E 64 65 73 20 20 53 59    es commandes  SY
029880:  4D 42 4F 4C 20 64 61 6E 73 20 47 68 6F 75 6C 27    MBOL dans Ghoul'
029890:  73 0D 0A 57 72 69 74 65 72 2E 0D 0A 0D 0A 0D 0A    s..Writer.......
0298A0:  55 49 20 47 57 2D 53 54 2C 20 72 65 6C 6F 67 65    UI GW-ST, reloge
0298B0:  75 72 20 64 65 20 6D 75 73 69 71 75 65 73 20 53    ur de musiques S
0298C0:  6F 75 6E 64 74 72 61 6B 6B 65 72 2E 0D 0A 0D 0A    oundtrakker.....
0298D0:  55 6E 20 64 65 73 20 20 75 74 69 6C 69 74 61 69    Un des  utilitai
0298E0:  72 65 73 20 6C 65 73 20 70 6C 75 73 20 70 72 61    res les plus pra
0298F0:  74 69 71 75 65 20 64 65 20 47 2E 57 2E 20 49 6C    tique de G.W. Il
029900:  20 73 27 61 67 69 74 20 74 6F 75 74 20 73 69 6D     s'agit tout sim
029910:  70 6C 65 6D 65 6E 74 20 64 27 75 6E 0D 0A 70 72    plement d'un..pr
029920:  6F 67 72 61 6D 6D 65 20 20 70 65 72 6D 65 74 74    ogramme  permett
029930:  61 6E 74 20 64 65 20 6D 6F 64 69 66 69 65 72 20    ant de modifier 
029940:  20 6C 65 73 20 61 64 72 65 73 73 65 20 64 27 69     les adresse d'i
029950:  6D 70 6C 61 6E 74 61 74 69 6F 6E 20 65 74 20 64    mplantation et d
029960:  27 65 78 65 63 75 74 69 6F 6E 0D 0A 64 27 75 6E    'execution..d'un
029970:  65 20 6D 75 73 69 71 75 65 20 53 6F 75 6E 64 74    e musique Soundt
029980:  72 61 6B 6B 65 72 2E 20 20 4C 27 6F 6E 20 70 65    rakker.  L'on pe
029990:  75 74 20 61 69 6E 73 69 20 75 74 69 6C 69 73 65    ut ainsi utilise
0299A0:  72 20 6C 65 73 20 6D 75 73 69 71 75 65 73 20 63    r les musiques c
0299B0:  6F 6D 70 6F 73 65 65 73 0D 0A 61 76 65 63 20 63    omposees..avec c
0299C0:  65 20 72 65 6D 61 72 71 75 61 62 6C 65 20 75 74    e remarquable ut
0299D0:  69 6C 69 74 61 69 72 65 20 64 61 6E 73 20 47 68    ilitaire dans Gh
0299E0:  6F 75 6C 27 73 20 57 72 69 74 65 72 2E 0D 0A 0D    oul's Writer....
0299F0:  0A 41 20 6E 6F 74 65 72 20 71 75 65 20 47 57 2D    .A noter que GW-
029A00:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
029A10:  23 00 01 00 02 09 4E E5 23 00 C1 02 00 00 00 02    #.....N.#.......
029A20:  23 00 C6 02 00 00 00 02 23 00 C2 02 00 00 00 02    #.......#.......
029A30:  23 00 C7 02 00 00 00 02 23 00 C3 02 00 00 00 02    #.......#.......
029A40:  23 00 C8 02 00 00 00 02 23 00 C4 02 00 00 00 02    #.......#.......
029A50:  23 00 C9 02 00 00 00 02 23 00 C5 02 00 00 00 02    #.......#.......
029A60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
029A70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
029A80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
029A90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
029AA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
029AB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
029AC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
029AD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
029AE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
029AF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
029B00:  67 65 6E 65 72 65 72 0D 0A 20 20 20 20 20 20 20    generer..       
029B10:  20 20 20 20 20 20 20 20 74 72 65 73 20 73 69 6D            tres sim
029B20:  70 6C 65 6D 65 6E 74 20 64 65 73 20 65 66 66 65    plement des effe
029B30:  74 73 20 76 61 72 69 65 73 20 64 27 65 66 66 61    ts varies d'effa
029B40:  63 65 6D 65 6E 74 2E 20 0D 0A 0D 0A 20 20 20 20    cement. ....    
029B50:  20 20 20 20 20 20 20 20 20 20 20 2A 20 4C 6F 6E               * Lon
029B60:  67 75 65 75 72 20 64 27 75 6E 20 66 69 63 68 69    gueur d'un fichi
029B70:  65 72 20 2E 47 57 45 20 3A 20 26 39 31 0D 0A 0D    er .GWE : &91...
029B80:  0A 46 69 63 68 69 65 72 20 2E 47 57 58 20 3A 20    .Fichier .GWX : 
029B90:  61 6E 69 6D 61 74 69 6F 6E 0D 0A 0D 0A 20 20 20    animation....   
029BA0:  20 20 20 20 20 20 20 20 20 20 20 20 43 65 20 66                Ce f
029BB0:  69 63 68 69 65 72 20 65 73 74 20 65 6E 20 66 61    ichier est en fa
029BC0:  69 74 20 75 6E 65 20 72 6F 75 74 69 6E 65 20 71    it une routine q
029BD0:  75 69 20 72 65 61 6C 69 73 65 20 75 6E 20 65 66    ui realise un ef
029BE0:  66 65 74 20 67 72 61 2D 0D 0A 20 20 20 20 20 20    fet gra-..      
029BF0:  20 20 20 20 20 20 20 20 20 70 68 69 71 75 65 20             phique 
029C00:  65 6E 20 61 72 72 69 65 72 65 2D 70 6C 61 6E 20    en arriere-plan 
029C10:  64 75 20 74 65 78 74 65 20 28 75 6E 69 71 75 65    du texte (unique
029C20:  6D 65 6E 74 20 70 6F 75 72 20 75 6E 20 74 65 78    ment pour un tex
029C30:  74 65 20 65 6E 0D 0A 20 20 20 20 20 20 20 20 20    te en..         
029C40:  20 20 20 20 20 20 6D 6F 64 65 20 31 29 2E 20 43          mode 1). C
029C50:  65 74 74 65 20 72 6F 75 74 69 6E 65 20 64 6F 69    ette routine doi
029C60:  74 20 72 65 70 6F 6E 64 72 65 20 61 20 70 6C 75    t repondre a plu
029C70:  73 69 65 75 72 73 20 63 72 69 74 65 72 65 73 20    sieurs criteres 
029C80:  3A 0D 0A 0D 0A 20 20 20 20 20 20 20 20 20 20 20    :....           
029C90:  20 20 20 20 20 20 20 20 20 20 20 20 2A 20 61 64                * ad
029CA0:  72 65 73 73 65 20 64 27 69 6D 70 6C 61 6E 74 61    resse d'implanta
029CB0:  74 69 6F 6E 20 3A 20 26 39 36 30 30 0D 0A 20 20    tion : &9600..  
029CC0:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
029CD0:  20 20 20 20 20 2A 20 61 64 72 65 73 73 65 20 64         * adresse d
029CE0:  27 69 6E 69 61 6C 69 73 61 74 69 6F 6E 20 3A 20    'inialisation : 
029CF0:  26 39 36 30 30 0D 0A 20 20 20 20 20 20 20 20 20    &9600..         
029D00:  65 20 63 65 20 70 72 6F 2D 0D 0A 67 72 61 6D 6D    e ce pro-..gramm
029D10:  65 20 20 65 73 74 20 64 65 73 74 69 6E 65 20 61    e  est destine a
029D20:  20 65 74 72 65 20 64 69 66 66 75 73 65 20 64 61     etre diffuse da
029D30:  6E 73 20 74 6F 75 74 65 20 20 6C 27 45 75 72 6F    ns toute  l'Euro
029D40:  70 65 20 28 73 69 20 63 65 20 6E 27 65 73 74 20    pe (si ce n'est 
029D50:  6C 61 20 70 6C 61 6E 65 74 65 0D 0A 65 6E 74 69    la planete..enti
029D60:  65 72 65 20 21 29 2C 20 20 69 6C 20 65 73 74 20    ere !),  il est 
029D70:  20 6E 6F 72 6D 61 6C 20 64 27 75 74 69 6C 69 73     normal d'utilis
029D80:  65 72 20 20 63 65 20 6C 61 6E 67 61 67 65 2C 20    er  ce langage, 
029D90:  6D 65 6D 65 20 73 69 20 20 63 65 6C 61 20 63 68    meme si  cela ch
029DA0:  61 67 72 69 6E 65 20 20 6C 65 73 0D 0A 61 64 65    agrine  les..ade
029DB0:  70 74 65 73 20 64 65 20 6C 61 20 6C 61 6E 67 75    ptes de la langu
029DC0:  65 20 64 65 20 4D 6F 6C 69 65 72 65 20 28 48 65    e de Moliere (He
029DD0:  6C 6C 6F 20 52 6F 62 65 72 74 20 21 29 2E 0D 0A    llo Robert !)...
029DE0:  0D 0A 54 6F 75 73 20 6C 65 73 20 66 69 63 68 69    ..Tous les fichi
029DF0:  65 72 73 20 70 61 72 61 6D 65 74 72 65 73 20 20    ers parametres  
029E00:  28 6D 75 73 69 71 75 65 73 2C 20 20 61 6E 69 6D    (musiques,  anim
029E10:  61 74 69 6F 6E 73 2C 20 20 63 6C 69 70 2D 61 72    ations,  clip-ar
029E20:  74 29 20 73 6F 6E 74 20 64 65 73 20 63 72 65 61    t) sont des crea
029E30:  2D 0D 0A 74 69 6F 6E 73 20 70 65 72 73 6F 6E 6E    -..tions personn
029E40:  65 6C 6C 65 73 2E 20 20 56 6F 75 73 20 70 6F 75    elles.  Vous pou
029E50:  76 65 7A 20 65 76 69 64 65 6D 6D 65 6E 74 20 20    vez evidemment  
029E60:  6C 65 73 20 75 74 69 6C 69 73 65 72 20 6C 69 62    les utiliser lib
029E70:  72 65 6D 65 6E 74 2C 20 20 6D 61 69 73 20 63 65    rement,  mais ce
029E80:  6C 61 0D 0A 73 65 72 61 69 74 20 73 79 6D 70 61    la..serait sympa
029E90:  20 64 27 69 6E 64 69 71 75 65 72 20 6C 65 75 72     d'indiquer leur
029EA0:  20 70 72 6F 76 65 6E 61 6E 63 65 20 20 71 75 61     provenance  qua
029EB0:  6E 64 20 76 6F 75 73 20 6C 65 73 20 72 65 70 72    nd vous les repr
029EC0:  65 6E 65 7A 20 20 64 61 6E 73 20 76 6F 73 20 70    enez  dans vos p
029ED0:  72 6F 2D 0D 0A 70 72 65 73 20 70 72 6F 67 72 61    ro-..pres progra
029EE0:  6D 6D 65 73 20 28 6A 65 20 70 65 6E 73 65 20 6E    mmes (je pense n
029EF0:  6F 74 61 6D 6D 65 6E 74 20 61 75 78 20 6D 75 73    otamment aux mus
029F00:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 2A 20                  * 
029F10:  61 64 72 65 73 73 65 20 64 27 65 78 65 63 75 74    adresse d'execut
029F20:  69 6F 6E 20 20 20 20 3A 20 26 39 36 30 33 0D 0A    ion    : &9603..
029F30:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
029F40:  20 20 20 20 20 20 20 2A 20 61 64 72 65 73 73 65           * adresse
029F50:  20 64 27 61 72 72 65 74 20 20 20 20 20 20 20 20     d'arret        
029F60:  3A 20 26 39 36 30 36 0D 0A 20 20 20 20 20 20 20    : &9606..       
029F70:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
029F80:  2A 20 6C 6F 6E 67 75 65 75 72 20 6D 61 78 69 6D    * longueur maxim
029F90:  61 6C 65 20 20 20 20 20 20 3A 20 26 30 41 30 30    ale      : &0A00
029FA0:  0D 0A 20 20 20 20 20 20 20 20 20 20 20 20 20 20    ..              
029FB0:  0D 0A 20 20 20 20 20 20 20 20 20 20 20 20 20 20    ..              
029FC0:  20 4C 61 20 72 6F 75 74 69 6E 65 20 6E 65 20 64     La routine ne d
029FD0:  6F 69 74 20 70 61 73 20 70 72 65 6E 64 72 65 20    oit pas prendre 
029FE0:  74 72 6F 70 20 64 65 20 74 65 6D 70 73 20 6D 61    trop de temps ma
029FF0:  63 68 69 6E 65 20 20 28 6D 61 78 69 6D 75 6D 0D    chine  (maximum.
02A000:  0A 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20    .               
02A010:  31 20 48 41 4C 54 29 2E 20 55 6E 65 20 73 65 75    1 HALT). Une seu
02A020:  6C 65 20 65 6E 63 72 65 20 65 73 74 20 64 69 73    le encre est dis
02A030:  70 6F 6E 69 62 6C 65 20 61 66 69 6E 20 64 65 20    ponible afin de 
02A040:  6E 65 20 70 61 73 20 70 6F 6C 6C 75 65 72 0D 0A    ne pas polluer..
02A050:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 6C                   l
02A060:  65 20 74 65 78 74 65 2C 20 6C 27 65 6E 63 72 65    e texte, l'encre
02A070:  20 6E 75 6D 65 72 6F 20 32 20 28 62 69 74 73 20     numero 2 (bits 
02A080:  26 46 30 2C 26 34 30 2C 26 32 30 2C 26 31 30 29    &F0,&40,&20,&10)
02A090:  2E 0D 0A 0D 0A 20 20 20 20 20 20 20 20 20 20 20    .....           
02A0A0:  20 20 20 20 4C 61 20 7A 6F 6E 65 20 76 69 64 65        La zone vide
02A0B0:  6F 20 64 65 20 74 72 61 76 61 69 6C 20 20 64 65    o de travail  de
02A0C0:  6C 69 6D 69 74 61 6E 74 20 6C 27 65 63 72 61 6E    limitant l'ecran
02A0D0:  20 6F 75 20 65 73 74 20 61 66 66 69 63 68 65 20     ou est affiche 
02A0E0:  6C 65 0D 0A 20 20 20 20 20 20 20 20 20 20 20 20    le..            
02A0F0:  20 20 20 74 65 78 74 65 20 73 65 20 73 69 74 75       texte se situ
02A100:  69 71 75 65 73 29 2E 0D 0A 41 20 6E 6F 74 65 72    iques)...A noter
02A110:  20 71 75 65 20 6C 65 73 20 74 68 65 6D 65 73 20     que les themes 
02A120:  20 53 49 4C 56 45 52 4D 41 2E 4D 55 53 20 65 74     SILVERMA.MUS et
02A130:  20 59 45 53 4F 44 2E 4D 55 53 20 73 6F 6E 74 20     YESOD.MUS sont 
02A140:  64 65 73 20 61 64 61 70 74 61 74 69 6F 6E 73 20    des adaptations 
02A150:  74 72 65 73 20 6C 69 2D 0D 0A 62 72 65 73 20 64    tres li-..bres d
02A160:  65 20 64 65 75 78 20 6D 75 73 69 71 75 65 73 20    e deux musiques 
02A170:  64 65 20 6A 65 75 78 20 3A 0D 0A 0D 0A 20 20 20    de jeux :....   
02A180:  20 20 20 20 20 20 20 20 20 20 20 20 20 2D 20 4B                 - K
02A190:  65 6E 27 73 20 6C 61 62 79 72 69 6E 74 68 20 33    en's labyrinth 3
02A1A0:  64 20 28 50 43 29 20 64 65 20 4B 65 6E 20 53 69    d (PC) de Ken Si
02A1B0:  6C 76 65 72 6D 61 6E 20 21 0D 0A 20 20 20 20 20    lverman !..     
02A1C0:  20 20 20 20 20 20 20 20 20 20 20 2D 20 4E 6F 64               - Nod
02A1D0:  65 73 20 6F 66 20 59 65 73 6F 64 20 28 43 50 43    es of Yesod (CPC
02A1E0:  29 20 64 65 20 4F 64 69 6E 20 73 6F 66 74 77 61    ) de Odin softwa
02A1F0:  72 65 2E 0D 0A 0D 0A 47 68 6F 75 6C 27 73 20 57    re.....Ghoul's W
02A200:  72 69 74 65 72 20 65 73 74 20 75 6E 20 70 72 6F    riter est un pro
02A210:  67 72 61 6D 6D 65 20 53 48 41 52 45 57 41 52 45    gramme SHAREWARE
02A220:  2E 20 20 56 6F 75 73 20 70 6F 75 76 65 7A 20 64    .  Vous pouvez d
02A230:  6F 6E 63 20 6C 65 20 63 6F 70 69 65 72 20 20 65    onc le copier  e
02A240:  74 20 6C 65 0D 0A 64 69 66 66 75 73 65 72 20 61    t le..diffuser a
02A250:  75 70 72 65 73 20 64 65 20 76 6F 73 20 61 6D 69    upres de vos ami
02A260:  73 20 73 6F 75 73 20 73 61 20 66 6F 72 6D 65 20    s sous sa forme 
02A270:  6F 72 69 67 69 6E 61 6C 65 20 28 6E 65 20 72 61    originale (ne ra
02A280:  6A 6F 75 74 65 7A 20 70 61 73 20 6F 75 20 6C 27    joutez pas ou l'
02A290:  65 6E 2D 0D 0A 6C 65 76 65 7A 20 70 61 73 20 64    en-..levez pas d
02A2A0:  65 20 66 69 63 68 69 65 72 73 20 73 75 72 20 6C    e fichiers sur l
02A2B0:  61 20 66 61 63 65 20 64 65 20 64 69 73 71 75 65    a face de disque
02A2C0:  74 74 65 20 71 75 65 20 70 72 65 6E 64 20 6C 65    tte que prend le
02A2D0:  20 6C 6F 67 69 63 69 65 6C 29 2E 0D 0A 0D 0A 53     logiciel).....S
02A2E0:  69 20 76 6F 75 73 20 75 74 69 6C 69 73 65 7A 20    i vous utilisez 
02A2F0:  72 65 67 75 6C 69 65 72 65 6D 65 6E 74 20 47 68    regulierement Gh
02A300:  65 20 65 6E 74 72 65 20 20 26 43 32 30 36 20 65    e entre  &C206 e
02A310:  74 20 26 46 43 39 46 2C 20 20 66 61 69 74 20 37    t &FC9F,  fait 7
02A320:  36 20 6F 63 74 65 74 73 20 64 65 20 6C 61 72 67    6 octets de larg
02A330:  65 0D 0A 20 20 20 20 20 20 20 20 20 20 20 20 20    e..             
02A340:  20 20 65 74 20 63 6F 6D 70 6F 72 74 65 20 31 34      et comporte 14
02A350:  34 20 6C 69 67 6E 65 73 2E 0D 0A 0D 0A 20 20 20    4 lignes.....   
02A360:  20 20 20 20 20 20 20 20 20 20 20 20 4C 27 61 64                L'ad
02A370:  72 65 73 73 65 20 64 27 69 6E 69 74 69 61 6C 69    resse d'initiali
02A380:  73 61 74 69 6F 6E 20 20 70 65 72 6D 65 74 20 20    sation  permet  
02A390:  64 65 20 6C 61 6E 63 65 72 20 75 6E 65 20 72 6F    de lancer une ro
02A3A0:  75 74 69 6E 65 20 20 6C 6F 72 73 0D 0A 20 20 20    utine  lors..   
02A3B0:  20 20 20 20 20 20 20 20 20 20 20 20 64 75 20 64                du d
02A3C0:  65 6D 61 72 72 61 67 65 20 20 64 65 20 6C 61 20    emarrage  de la 
02A3D0:  70 72 65 73 65 6E 74 61 74 69 6F 6E 2E 20 20 20    presentation.   
02A3E0:  43 65 6C 61 20 70 65 72 6D 65 74 20 70 61 72 20    Cela permet par 
02A3F0:  65 78 65 6D 70 6C 65 20 20 64 65 0D 0A 20 20 20    exemple  de..   
02A400:  20 20 20 20 20 20 20 20 20 20 20 20 63 72 65 65                cree
02A410:  72 20 75 6E 65 20 74 61 62 6C 65 20 64 65 20 63    r une table de c
02A420:  6F 6F 72 64 6F 6E 6E 65 65 73 20 75 74 69 6C 69    oordonnees utili
02A430:  73 65 65 20 70 61 72 20 75 6E 20 73 74 61 72 66    see par un starf
02A440:  69 65 6C 64 2E 0D 0A 0D 0A 20 20 20 20 20 20 20    ield.....       
02A450:  20 20 20 20 20 20 20 20 4C 27 61 64 72 65 73 73            L'adress
02A460:  65 20 64 27 61 72 72 65 74 20 6E 27 65 73 74 20    e d'arret n'est 
02A470:  75 74 69 6C 65 20 71 75 65 20 70 6F 75 72 20 64    utile que pour d
02A480:  65 73 20 61 6E 69 6D 61 74 69 6F 6E 73 20 75 74    es animations ut
02A490:  69 6C 69 73 61 6E 74 0D 0A 20 20 20 20 20 20 20    ilisant..       
02A4A0:  20 20 20 20 20 20 20 20 6C 65 73 20 73 70 72 69            les spri
02A4B0:  74 65 73 20 68 61 72 64 20 20 64 75 20 63 70 63    tes hard  du cpc
02A4C0:  20 2B 2E 20 20 50 6F 75 72 20 64 65 73 20 72 61     +.  Pour des ra
02A4D0:  69 73 6F 6E 73 20 20 64 65 20 63 6F 6D 70 61 74    isons  de compat
02A4E0:  69 62 69 6C 69 74 65 2C 0D 0A 20 20 20 20 20 20    ibilite,..      
02A4F0:  20 20 20 20 20 20 20 20 20 69 6C 20 65 73 74 20             il est 
02A500:  6F 75 6C 27 73 20 57 72 69 74 65 72 2C 20 76 6F    oul's Writer, vo
02A510:  75 73 20 61 76 65 63 20 6C 65 20 64 65 76 6F 69    us avec le devoi
02A520:  72 20 6D 6F 72 61 6C 20 64 27 61 63 2D 0D 0A 71    r moral d'ac-..q
02A530:  75 69 74 74 65 72 20 75 6E 65 20 70 65 74 69 74    uitter une petit
02A540:  65 20 63 6F 6E 74 72 69 62 75 74 69 6F 6E 20 76    e contribution v
02A550:  6F 6C 6F 6E 74 61 69 72 65 2E 20 43 65 20 64 72    olontaire. Ce dr
02A560:  6F 69 74 20 64 27 75 74 69 6C 69 73 61 74 69 6F    oit d'utilisatio
02A570:  6E 20 65 73 74 20 6D 6F 64 65 73 74 65 2E 0D 0A    n est modeste...
02A580:  0D 0A 20 20 20 20 20 20 20 20 20 20 20 20 20 20    ..              
02A590:  20 20 20 20 20 2A 20 33 30 20 46 72 61 6E 63 73         * 30 Francs
02A5A0:  20 66 72 61 6E 63 61 69 73 20 28 74 69 6D 62 72     francais (timbr
02A5B0:  65 73 2C 20 62 69 6C 6C 65 74 2C 20 63 68 65 71    es, billet, cheq
02A5C0:  75 65 2C 20 70 69 65 63 65 73 29 0D 0A 20 20 20    ue, pieces)..   
02A5D0:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
02A5E0:  2A 20 36 20 55 2E 53 20 64 6F 6C 6C 61 72 73 0D    * 6 U.S dollars.
02A5F0:  0A 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20    .               
02A600:  20 20 20 20 2A 20 31 30 20 44 65 75 74 73 63 68        * 10 Deutsch
02A610:  6D 61 72 6B 73 0D 0A 20 20 20 20 20 20 20 20 20    marks..         
02A620:  20 20 20 20 20 20 20 20 20 20 2A 20 33 20 4C 69              * 3 Li
02A630:  76 72 65 73 20 61 6E 67 6C 61 69 73 65 73 0D 0A    vres anglaises..
02A640:  0D 0A 4A 65 20 6D 65 20 6D 65 20 66 61 69 73 20    ..Je me me fais 
02A650:  70 61 73 20 74 72 6F 70 20 64 27 69 6C 6C 75 73    pas trop d'illus
02A660:  69 6F 6E 20 73 75 72 20 6C 65 73 20 72 65 74 6F    ion sur les reto
02A670:  6D 62 65 65 73 20 66 69 6E 61 6E 63 69 65 72 65    mbees financiere
02A680:  73 20 64 65 20 47 2E 57 2E 20 20 53 65 70 74 0D    s de G.W.  Sept.
02A690:  0A 70 65 72 73 6F 6E 6E 65 73 20 20 73 65 75 6C    .personnes  seul
02A6A0:  65 6D 65 6E 74 20 6D 27 6F 6E 74 20 20 72 65 70    ement m'ont  rep
02A6B0:  6F 6E 64 75 20 70 6F 75 72 20 4D 75 6C 74 69 20    ondu pour Multi 
02A6C0:  4D 61 72 6B 20 21 20 20 4D 61 69 73 20 20 63 65    Mark !  Mais  ce
02A6D0:  20 6E 27 65 73 74 20 70 61 73 20 75 6E 65 0D 0A     n'est pas une..
02A6E0:  72 61 69 73 6F 6E 20 70 6F 75 72 20 6E 65 20 70    raison pour ne p
02A6F0:  61 73 20 70 61 79 65 72 2C 20 6E 27 65 73 74 20    as payer, n'est 
02A700:  4F 42 4C 49 47 41 54 4F 49 52 45 20 64 65 20 6C    OBLIGATOIRE de l
02A710:  27 75 74 69 6C 69 73 65 72 2E 0D 0A 20 20 20 20    'utiliser...    
02A720:  20 20 20 20 20 20 20 20 20 20 20 20 0D 0A 0D 0A                ....
02A730:  56 49 49 20 43 6F 6D 6D 65 6E 74 61 69 72 65 73    VII Commentaires
02A740:  20 73 75 72 20 47 68 6F 75 6C 27 73 20 57 72 69     sur Ghoul's Wri
02A750:  74 65 72 0D 0A 0D 0A 4C 27 69 64 65 65 20 64 65    ter....L'idee de
02A760:  20 6C 61 20 63 72 65 61 74 69 6F 6E 20 64 65 20     la creation de 
02A770:  63 65 20 70 72 6F 67 72 61 6D 6D 65 20 6D 27 65    ce programme m'e
02A780:  73 74 20 76 65 6E 75 65 20 6C 6F 72 73 71 75 65    st venue lorsque
02A790:  20 6A 27 61 69 20 72 65 63 75 20 6C 65 20 4C 65     j'ai recu le Le
02A7A0:  74 74 65 72 27 73 0D 0A 63 72 65 61 74 6F 72 20    tter's..creator 
02A7B0:  64 65 20 4B 61 6E 67 61 72 6F 6F 2E 20 20 4A 65    de Kangaroo.  Je
02A7C0:  20 6D 65 20 73 65 72 76 61 69 73 20 20 64 65 70     me servais  dep
02A7D0:  75 69 73 20 70 61 73 20 6D 61 6C 20 64 65 20 74    uis pas mal de t
02A7E0:  65 6D 70 73 20 64 65 20 66 69 63 68 69 65 72 73    emps de fichiers
02A7F0:  20 74 65 78 74 65 73 0D 0A 70 6F 75 72 20 63 6F     textes..pour co
02A800:  72 72 65 73 70 6F 6E 64 72 65 20 61 76 65 63 20    rrespondre avec 
02A810:  6D 65 73 20 61 6D 69 73 20 70 6F 73 73 65 73 73    mes amis possess
02A820:  65 75 72 73 20 64 65 20 43 50 43 2E 20 4A 27 61    eurs de CPC. J'a
02A830:  69 20 61 70 70 72 65 63 69 65 20 6C 65 20 74 72    i apprecie le tr
02A840:  61 76 61 69 6C 20 64 65 0D 0A 4B 61 6E 67 61 72    avail de..Kangar
02A850:  6F 6F 20 6D 61 69 73 20 6D 65 20 73 75 69 73 20    oo mais me suis 
02A860:  64 69 74 20 71 75 27 69 6C 20 65 74 61 69 74 20    dit qu'il etait 
02A870:  70 6F 73 73 69 62 6C 65 20 64 65 20 66 61 69 72    possible de fair
02A880:  65 20 6D 69 65 75 78 2E 20 4C 65 73 20 69 64 65    e mieux. Les ide
02A890:  65 73 20 76 65 6E 61 6E 74 0D 0A 61 76 65 63 20    es venant..avec 
02A8A0:  6C 61 20 70 72 6F 67 72 61 6D 6D 61 74 69 6F 6E    la programmation
02A8B0:  2C 20 20 6C 65 20 63 6F 6E 63 65 70 74 20 64 65    ,  le concept de
02A8C0:  20 47 2E 57 2E 20 73 27 65 73 74 20 20 63 6F 6E     G.W. s'est  con
02A8D0:  73 69 64 65 72 61 62 6C 65 6D 65 6E 74 20 65 6E    siderablement en
02A8E0:  72 69 63 68 69 2C 20 20 61 75 0D 0A 70 6F 69 6E    richi,  au..poin
02A8F0:  74 20 64 65 20 64 65 76 65 6E 69 72 20 75 6E 20    t de devenir un 
02A900:  63 65 20 70 61 73 20 21 20 50 61 72 20 72 61 70    ce pas ! Par rap
02A910:  70 6F 72 74 20 61 20 4D 75 6C 74 69 20 4D 61 72    port a Multi Mar
02A920:  6B 2C 20 6C 65 73 20 74 61 72 69 66 73 0D 0A 6F    k, les tarifs..o
02A930:  6E 74 20 61 75 67 6D 65 6E 74 65 2E 20 20 20 43    nt augmente.   C
02A940:  65 6C 61 20 63 6F 72 72 65 73 70 6F 6E 64 20 61    ela correspond a
02A950:  20 6C 61 20 63 68 61 72 67 65 20 64 65 20 74 72     la charge de tr
02A960:  61 76 61 69 6C 20 71 75 65 20 6D 27 61 20 69 6D    avail que m'a im
02A970:  70 6F 73 65 20 47 2E 57 20 28 69 6C 0D 0A 65 73    pose G.W (il..es
02A980:  74 20 61 73 73 65 7A 20 64 69 66 66 69 63 69 6C    t assez difficil
02A990:  65 20 20 64 65 20 72 65 6D 70 6C 69 72 20 75 6E    e  de remplir un
02A9A0:  65 20 66 61 63 65 20 20 64 65 20 64 69 73 71 75    e face  de disqu
02A9B0:  65 74 74 65 20 20 61 76 65 63 20 64 65 73 20 20    ette  avec des  
02A9C0:  66 69 63 68 69 65 72 73 20 64 65 0D 0A 70 61 72    fichiers de..par
02A9D0:  61 6D 65 74 72 65 73 20 6E 27 65 78 63 65 64 61    ametres n'exceda
02A9E0:  6E 74 20 70 61 73 20 71 75 65 6C 71 75 65 73 20    nt pas quelques 
02A9F0:  4B 6F 20 21 29 2E 0D 0A 0D 0A 56 6F 75 73 20 61    Ko !).....Vous a
02AA00:  76 65 7A 20 64 65 73 20 70 72 6F 62 6C 65 6D 65    vez des probleme
02AA10:  73 2C 20 64 65 73 20 71 75 65 73 74 69 6F 6E 73    s, des questions
02AA20:  20 3F 20 56 6F 75 73 20 76 6F 75 6C 65 7A 20 6D     ? Vous voulez m
02AA30:  65 20 66 61 69 72 65 20 70 61 72 76 65 6E 69 72    e faire parvenir
02AA40:  20 76 6F 73 20 66 69 2D 0D 0A 63 68 69 65 72 73     vos fi-..chiers
02AA50:  20 70 61 72 61 6D 65 74 72 65 73 20 70 6F 75 72     parametres pour
02AA60:  20 75 6E 65 20 65 76 65 6E 74 75 65 6C 6C 65 20     une eventuelle 
02AA70:  63 6F 6D 70 69 6C 61 74 69 6F 6E 20 64 65 20 72    compilation de r
02AA80:  6F 75 74 69 6E 65 73 20 65 74 20 67 72 61 70 68    outines et graph
02AA90:  69 73 6D 65 73 20 3F 0D 0A 56 6F 75 73 20 76 6F    ismes ?..Vous vo
02AAA0:  75 6C 65 7A 20 72 65 67 6C 65 72 20 76 6F 74 72    ulez regler votr
02AAB0:  65 20 63 6F 6E 74 72 69 62 75 74 69 6F 6E 20 76    e contribution v
02AAC0:  6F 6C 6F 6E 74 61 69 72 65 20 3F 20 45 63 72 69    olontaire ? Ecri
02AAD0:  76 65 7A 20 6D 6F 69 20 21 0D 0A 0D 0A 20 20 20    vez moi !....   
02AAE0:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
02AAF0:  20 20 20 20 20 20 20 20 4D 6F 6E 63 68 61 74 72            Monchatr
02AB00:  76 65 72 69 74 61 62 6C 65 20 6B 69 74 20 64 65    veritable kit de
02AB10:  20 63 72 65 61 74 69 6F 6E 20 64 65 20 70 72 65     creation de pre
02AB20:  73 65 6E 74 61 74 69 6F 6E 20 64 65 20 74 65 78    sentation de tex
02AB30:  74 65 73 2E 0D 0A 0D 0A 4F 6E 20 70 6F 75 72 72    tes.....On pourr
02AB40:  61 20 6D 65 20 72 65 70 72 6F 63 68 65 72 20 20    a me reprocher  
02AB50:  6C 61 20 70 72 6F 67 72 61 6D 6D 61 74 69 6F 6E    la programmation
02AB60:  20 20 72 65 6C 61 74 69 76 65 6D 65 6E 74 20 74      relativement t
02AB70:  69 6D 69 64 65 20 20 64 75 20 63 6F 72 70 73 20    imide  du corps 
02AB80:  64 65 20 47 2E 57 2C 0D 0A 28 20 70 61 73 20 64    de G.W,..( pas d
02AB90:  27 6F 76 65 72 73 63 61 6E 2C 20 64 65 20 72 75    'overscan, de ru
02ABA0:  70 74 75 72 65 73 20 20 6E 69 20 64 65 20 73 63    ptures  ni de sc
02ABB0:  72 6F 6C 6C 69 6E 67 20 68 61 72 64 29 2C 20 20    rolling hard),  
02ABC0:  6D 61 69 73 20 6A 27 61 69 20 76 6F 75 6C 75 20    mais j'ai voulu 
02ABD0:  66 61 69 72 65 20 75 6E 0D 0A 70 72 6F 67 72 61    faire un..progra
02ABE0:  6D 6D 65 20 63 6F 6D 70 61 74 69 62 6C 65 20 61    mme compatible a
02ABF0:  76 65 63 20 74 6F 75 73 20 6C 65 73 20 63 70 63    vec tous les cpc
02AC00:  2C 20 74 6F 75 72 6E 61 6E 74 20 73 75 72 20 6C    , tournant sur l
02AC10:  65 73 20 63 70 63 20 34 36 34 20 28 36 34 6B 6F    es cpc 464 (64ko
02AC20:  20 64 65 20 52 41 4D 29 2C 0D 0A 75 74 69 6C 69     de RAM),..utili
02AC30:  73 61 62 6C 65 20 61 20 70 61 72 74 69 72 20 64    sable a partir d
02AC40:  75 20 42 61 73 69 63 20 20 65 74 20 6E 65 20 74    u Basic  et ne t
02AC50:  6F 75 63 68 61 6E 74 20 70 61 73 20 20 61 75 78    ouchant pas  aux
02AC60:  20 7A 6F 6E 65 20 64 65 20 52 41 4D 20 20 72 65     zone de RAM  re
02AC70:  73 65 72 76 65 65 73 20 61 75 0D 0A 73 79 73 74    servees au..syst
02AC80:  65 6D 65 2E 20 20 43 65 6C 61 20 61 20 66 6F 72    eme.  Cela a for
02AC90:  63 65 6D 65 6E 74 20 63 6F 6E 64 75 69 74 20 61    cement conduit a
02ACA0:  20 71 75 65 6C 71 75 65 73 20 6C 69 6D 69 74 61     quelques limita
02ACB0:  74 69 6F 6E 73 2E 0D 0A 0D 0A 4C 65 73 20 75 74    tions.....Les ut
02ACC0:  69 6C 69 74 61 69 72 65 73 20 64 65 20 47 68 6F    ilitaires de Gho
02ACD0:  75 6C 27 73 20 57 72 69 74 65 72 20 6F 6E 74 20    ul's Writer ont 
02ACE0:  74 6F 75 73 20 64 65 73 20 74 65 78 74 65 73 20    tous des textes 
02ACF0:  65 6E 20 61 6E 67 6C 61 69 73 2E 20 43 6F 6D 6D    en anglais. Comm
02AD00:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
02AD10:  24 00 01 00 02 09 4E E5 24 00 C1 02 00 00 00 02    $.....N.$.......
02AD20:  24 00 C6 02 00 00 00 02 24 00 C2 02 00 00 00 02    $.......$.......
02AD30:  24 00 C7 02 00 00 00 02 24 00 C3 02 00 00 00 02    $.......$.......
02AD40:  24 00 C8 02 00 00 00 02 24 00 C4 02 00 00 00 02    $.......$.......
02AD50:  24 00 C9 02 00 00 00 02 24 00 C5 02 00 00 00 02    $.......$.......
02AD60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02AD70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02AD80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02AD90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02ADA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02ADB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02ADC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02ADD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02ADE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02ADF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02AE00:  65 20 48 65 72 76 65 0D 0A 20 20 20 20 20 20 20    e Herve..       
02AE10:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
02AE20:  20 20 20 20 43 6F 6C 6C 65 67 65 2C 20 31 20 72        College, 1 r
02AE30:  75 65 20 64 65 73 20 6F 72 6D 65 73 0D 0A 20 20    ue des ormes..  
02AE40:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
02AE50:  20 20 20 20 20 20 20 20 20 34 35 33 32 30 20 43             45320 C
02AE60:  6F 75 72 74 65 6E 61 79 0D 0A 20 20 20 20 20 20    ourtenay..      
02AE70:  20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20                    
02AE80:  20 20 20 20 20 46 72 61 6E 63 65 0D 0A 0D 0A 55         France....U
02AE90:  6E 65 20 70 65 74 69 74 65 20 61 6E 65 63 64 6F    ne petite anecdo
02AEA0:  74 65 20 70 6F 75 72 20 74 65 72 6D 69 6E 65 72    te pour terminer
02AEB0:  2E 20 41 20 76 6F 74 72 65 20 61 76 69 73 2C 20    . A votre avis, 
02AEC0:  20 64 27 6F 75 20 76 69 65 6E 74 20 6C 65 20 6E     d'ou vient le n
02AED0:  6F 6D 20 64 65 20 20 63 65 20 70 72 6F 2D 0D 0A    om de  ce pro-..
02AEE0:  67 72 61 6D 6D 65 20 3F 20 43 27 65 73 74 20 75    gramme ? C'est u
02AEF0:  6E 20 63 6C 69 6E 20 64 27 6F 65 69 6C 20 61 75    n clin d'oeil au
02AF00:  20 47 68 6F 73 74 20 57 72 69 74 65 72 20 64 65     Ghost Writer de
02AF10:  20 4D 54 49 20 65 74 20 61 20 75 6E 20 6A 65 75     MTI et a un jeu
02AF20:  20 43 50 43 20 73 6F 72 74 69 20 63 68 65 7A 0D     CPC sorti chez.
02AF30:  0A 55 2E 53 2E 47 6F 6C 64 20 76 65 72 73 20 31    .U.S.Gold vers 1
02AF40:  39 38 39 2C 20 47 68 6F 75 6C 27 73 27 6E 27 47    989, Ghoul's'n'G
02AF50:  68 6F 73 74 20 21 0D 0A 0D 0A 53 6F 75 6E 64 74    host !....Soundt
02AF60:  72 61 6B 6B 65 72 20 28 63 29 20 4E 65 77 20 41    rakker (c) New A
02AF70:  67 65 20 53 6F 66 74 77 61 72 65 0D 0A 54 68 65    ge Software..The
02AF80:  20 41 64 76 61 6E 63 65 64 20 4F 43 50 20 61 72     Advanced OCP ar
02AF90:  74 20 53 74 75 64 69 6F 20 28 63 29 20 52 61 69    t Studio (c) Rai
02AFA0:  6E 62 69 72 64 0D 0A 0D 0A 1A 31 2E 30 20 2A 0D    nbird.....1.0 *.
02AFB0:  0A 0D 0A 20 20 20 20 20 20 20 20 20 20 20 20 20    ...             
02AFC0:  20 20 20 20 20 20 20 20 20 54 6F 6D 20 65 74 20             Tom et 
02AFD0:  4A 65 72 72 79 20 6F 66 20 47 50 41 20 28 63 29    Jerry of GPA (c)
02AFE0:  20 31 39 39 34 0D 0A 0D 0A 20 20 20 20 20 20 20     1994....       
02AFF0:  20 20 20 20 20 20 20 20 20 20 20 20 2A 20 43 65                * Ce
02B000:  5B 4A 49 4B E5 DD E1 C5 DD 7E 00 4F 06 00 21 A9    [JIK.....~.O..!.
02B010:  05 09 7E 12 13 DD 23 C1 10 ED C9 21 E2 02 7E 32    ..~...#....!..~2
02B020:  25 90 23 7E 32 22 90 23 7E 32 23 90 21 E5 02 06    %.#~2".#~2#.!...
02B030:  08 11 1A 90 CD C4 05 21 ED 02 06 01 11 17 90 CD    .......!........
02B040:  C4 05 21 EE 02 06 01 11 03 90 CD C4 05 21 EF 02    ..!..........!..
02B050:  06 01 11 04 90 CD C4 05 3A F1 02 32 05 90 21 F2    ........:..2..!.
02B060:  02 06 10 11 06 90 CD C4 05 3A F0 02 32 24 90 2A    .........:..2$.*
02B070:  70 08 23 22 15 94 2A 70 08 7E 32 18 90 A7 20 15    p.#"..*p.~2... .
02B080:  3A 06 96 FE C9 28 02 A7 C0 3E C9 32 00 96 32 03    :....(...>.2..2.
02B090:  96 32 06 96 C9 3A 01 96 A7 C8 3E C3 32 00 96 32    .2...:....>.2..2
02B0A0:  03 96 C9 CD 4D 05 CD 70 06 A7 CA 84 06 C3 8F 06    ....M..p........
02B0B0:  2A 70 08 7E 21 28 08 06 05 A7 28 01 04 7E A7 C8    *p.~!(....(..~..
02B0C0:  23 10 FA C9 21 6D 05 CD 06 08 C9 CD 03 08 C9 CD    #...!m..........
02B0D0:  DB 05 21 7F 05 CD 06 08 CD 18 BB FE FC 28 EC 3E    ..!..........(.>
02B0E0:  02 CD 0E BC CD 00 90 3E 02 CD 0E BC C9 E5 21 55    .......>......!U
02B0F0:  00 01 0E 00 A7 28 04 09 3D 20 FC E5 D1 E5 13 01    .....(..= ......
02B100:  0A 00 36 20 ED B0 D1 E1 23 23 01 08 00 ED B0 C9    ..6 ....##......
02B110:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02B120:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02B130:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02B140:  C3 33 07 C3 1D 07 09 01 49 6E 74 72 6F 20 6C 65    .3......Intro le
02B150:  6E 67 74 68 20 3D 20 30 30 20 4B 6F 00 2A 70 08    ngth = 00 Ko.*p.
02B160:  11 FF 9F 7B 95 30 01 15 5F 7A 94 57 13 EB 22 72    ...{.0.._z.W.."r
02B170:  08 EB C9 2A 72 08 01 80 00 09 11 00 00 7C D6 28    ...*r........|.(
02B180:  38 03 14 18 F9 C6 28 D6 04 38 03 1C 18 F9 7D A7    8.....(..8....}.
02B190:  28 01 1C 7B C6 30 32 18 07 7A C6 30 32 17 07 21    (..{.02..z.02..!
02B1A0:  06 07 C3 06 08 00 00 00 00 00 00 00 00 00 00 00    ................
02B1B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02B1C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02B1D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02B1E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02B1F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02B200:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02B210:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02B220:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02B230:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02B240:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02B250:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02B260:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02B270:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02B280:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02B290:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02B2A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02B2B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02B2C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02B2D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02B2E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02B2F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02B300:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02B310:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02B320:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02B330:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02B340:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02B350:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02B360:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02B370:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02B380:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02B390:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02B3A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02B3B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02B3C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02B3D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02B3E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02B3F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02B400:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02B410:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02B420:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02B430:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02B440:  C3 74 08 C3 08 09 C3 F6 08 01 45 20 20 20 20 20    .t........E     
02B450:  20 20 20 2E 20 20 20 00 07 3F 20 20 20 20 20 20       .   ..?      
02B460:  20 20 2E 20 20 20 00 00 00 00 00 00 00 00 07 3F      .   .........?
02B470:  20 20 20 20 20 20 20 20 2E 42 49 4E 00 07 3F 20            .BIN..? 
02B480:  20 20 20 20 20 20 20 2E 20 20 20 00 4D 55 53 46           .   .MUSF
02B490:  4E 54 47 57 4C 47 57 43 47 57 45 47 57 58 00 00    NTGWLGWCGWEGWX..
02B4A0:  00 20 21 22 25 28 29 2A 2E 3C 3E 3F 5B 5D 7B 7D    . !"%()*.<>?[]{}
02B4B0:  F3 11 00 00 21 00 11 11 01 11 01 00 70 36 00 ED    ....!.......p6..
02B4C0:  B0 21 00 96 11 01 96 01 00 10 36 00 ED B0 3A 00    .!........6...:.
02B4D0:  A7 F5 21 FF AB 11 40 00 0E 07 CD CE BC F1 32 00    ..!...@.......2.
02B4E0:  A7 4F 3A AE 0A 81 32 AE 0A CD 4C 09 3E 02 CD 0E    .O:...2...L.>...
02B4F0:  BC 21 0B 08 11 B0 0A 01 0C 00 ED B0 01 00 00 AF    .!..............
02B500:  CD 32 BC 01 1A 1A 3E 01 CD 32 BC 01 00 00 CD 38    .2....>..2.....8
02B510:  BC CD D7 08 C3 BD 0A 21 99 09 CD F6 08 21 BF 09    .......!.....!..
02B520:  CD F6 08 21 04 0A CD F6 08 21 A3 0A CD F6 08 21    ...!.....!£....!
02B530:  50 0A CD F6 08 C9 5E 23 56 23 EB CD 75 BB EB 7E    P.....^#V#..u..~
02B540:  A7 C8 CD 5A BB 23 18 F7 21 05 00 11 18 4F CD 66    ...Z.#..!....O.f
02B550:  BB CD 6C BB 21 00 00 11 18 4F CD 66 BB C9 21 05    ..l.!....O.f..!.
02B560:  00 11 18 4F CD 66 BB CD 6C BB C9 21 B0 0A 11 B1    ...O.f..l..!....
02B570:  0A 01 0B 00 36 20 ED B0 21 0B 08 11 0C 08 01 07    ....6 ..!.......
02B580:  00 36 20 ED B0 21 09 08 CD DB 0E C9 21 5F 09 CD    .6 ..!......!_..
02B590:  D4 BC 22 60 09 79 32 62 09 3E FF DF 60 09 C9 81    .."`.y2b.>..`...
02B5A0:  00 00 00 CD 1E 09 21 88 09 CD D4 BC 22 96 09 79    ......!....."..y
02B5B0:  32 98 09 3E 01 DD 21 8C 09 DF 96 09 21 00 00 11    2..>..!.....!...
02B5C0:  18 4F CD 66 BB C3 BD 0A 44 49 D2 00 8E 09 05 91    .O.f....DI......
02B5D0:  09 2A 2E 20 20 20 00 00 00 01 01 47 68 6F 75 6C    .*.   .....Ghoul
02B5E0:  27 73 20 57 72 69 74 65 72 20 65 64 69 74 6F 72    's Writer editor
02B5F0:  20 20 47 50 41 20 28 63 29 20 31 39 39 34 00 03      GPA (c) 1994..
02B600:  00 47 57 4C 49 4E 4B 20 20 42 49 4E 00 00 00 00    .GWLINK  BIN....
02B610:  00 00 02 00 00 40 60 00 60 10 00 00 00 00 00 00    .....@`.`.......
02B620:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02B630:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02B640:  60 10 00 67 04 30 01 25 7C 90 38 F4 AF C9 7B BD    `..g.0.%|.8...{.
02B650:  20 EE 7A BC 20 EA AF C9 07 01 46 69 6C 65 20 69     .z. .....File i
02B660:  73 20 74 6F 6F 20 6C 6F 6E 67 2E 2E 2E 00 07 01    s too long......
02B670:  42 61 64 20 73 74 61 72 74 20 61 64 72 65 73 73    Bad start adress
02B680:  C3 A7 00 C3 63 06 C3 70 06 C3 AD 06 C3 DB 05 00    ....c..p........
02B690:  01 22 02 07 14 6E 6F 74 20 6C 6F 61 64 65 64 2E    ."...not loaded.
02B6A0:  00 08 14 6E 6F 74 20 6C 6F 61 64 65 64 2E 00 09    ...not loaded...
02B6B0:  14 6E 6F 74 20 6C 6F 61 64 65 64 2E 00 0A 14 6E    .not loaded....n
02B6C0:  6F 74 20 6C 6F 61 64 65 64 2E 00 0B 14 6E 6F 74    ot loaded....not
02B6D0:  20 6C 6F 61 64 65 64 2E 00 0C 14 6E 6F 74 20 6C     loaded....not l
02B6E0:  6F 61 64 65 64 2E 00 3A 4F 00 A7 CC AA 01 CD 03    oaded..:O.......
02B6F0:  08 CD E2 01 CD BF 01 21 22 02 22 51 00 3E 01 32    .......!"."Q.>.2
02B700:  50 00 CD F1 01 CD 18 BB FE F0 CA E7 00 FE F1 CA    P...............
02B710:  03 01 FE F3 CA 1F 01 FE F2 CA 3D 01 FE FC CA E3    ..........=.....
02B720:  00 18 E2 CD 03 08 C9 3A 50 00 FE 01 CA C5 00 3D    .......:P......=
02B730:  32 50 00 CD F7 01 2A 51 00 01 FB FF 09 22 51 00    2P....*Q....."Q.
02B740:  C3 C2 00 3A 50 00 FE 20 CA C5 00 3C 32 50 00 CD    ...:P.. ...<2P..
02B750:  F7 01 2A 51 00 01 05 00 09 22 51 00 C3 C2 00 2A    ..*Q....."Q....*
02B760:  51 00 E5 DD E1 21 E1 02 3A 50 00 06 00 4F 09 7E    Q....!..:P...O.~
02B770:  DD BE 04 28 05 3C 77 CD 5B 01 C3 C5 00 2A 51 00    ...(.<w.[....*Q.
02B780:  E5 DD E1 21 E1 02 3A 50 00 4F 06 00 09 7E DD BE    ...!..:P.O...~..
02B790:  03 28 05 3D 77 CD 5B 01 C3 C5 00 DD 7E 02 FE 00    .(.=w.[.....~...
02B7A0:  20 1C 7E A7 20 13 21 14 02 DD 7E 00 77 DD 7E 01     .~. .!...~.w.~.
02B7B0:  C6 1E 23 77 2B CD 06 08 C9 21 0E 02 18 EB 7E 47    ..#w+....!....~G
02B7C0:  0E FF 0C D6 0A 30 FB C6 3A C5 F5 DD 7E 00 6F DD    .....0..:...~.o.
02B7D0:  7E 01 C6 1E 67 E5 24 CD 75 BB E1 F1 CD 5A BB CD    ~...g.$.u....Z..
02B7E0:  75 BB C1 79 C6 30 CD 5A BB C9 21 C2 02 11 E2 02    u..y.0.Z..!.....
02B7F0:  0E 20 06 00 ED B0 3E 01 32 4F 00 32 50 00 C9 AF    . ....>.2O.2P...
02B800:  01 46 69 6C 65 20 74 79 70 65 20 3A 20 5B 54 5D    .File type : [T]
02B810:  65 78 74 20 20 5B 46 5D 6F 6E 74 20 20 5B 4C 5D    ext  [F]ont  [L]
02B820:  6F 67 6F 20 20 5B 4D 5D 75 73 69 63 20 20 5B 31    ogo  [M]usic  [1
02B830:  5D 73 74 20 73 66 78 20 20 20 5B 32 5D 6E 64 20    ]st sfx   [2]nd 
02B840:  73 66 78 00 04 01 43 6F 6D 6D 61 6E 64 20 20 20    sfx...Command   
02B850:  3A 20 28 44 29 69 72 20 20 20 28 41 29 3A 20 20    : (D)ir   (A):  
02B860:  20 20 28 42 29 3A 20 20 20 20 28 4F 29 70 65 6E      (B):    (O)pen
02B870:  20 20 20 28 53 29 61 76 65 20 61 6C 6C 20 20 28       (S)ave all  (
02B880:  43 29 6F 6E 66 69 67 20 20 28 56 29 69 65 77 00    C)onfig  (V)iew.
02B890:  05 01 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A    ................
02B8A0:  9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A    ................
02B8B0:  9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A    ................
02B8C0:  9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A    ................
02B8D0:  9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A    ................
02B8E0:  9A 9A 00 01 3A 46 69 6C 65 20 20 20 3A 20 41 3A    ....:File   : A:
02B8F0:  20 20 20 20 20 20 20 20 2E 20 20 20 00 CD 18 BB            .   ....
02B900:  FE 31 CA 39 0F FE 32 CA 40 0F E6 DF FE 49 CA 14    .1.9..2.@....I..
02B910:  0B FE 44 CA 63 09 FE 4F CA 99 0B FE 53 CA 51 0D    ..D.c..O....S.Q.
02B920:  FE 41 CA C0 0E FE 42 CA CD 0E FE 54 CA F4 0E FE    .A....B....T....
02B930:  4C CA 2B 0F FE 46 CA 32 0F FE 4D CA 24 0F FE 43    L.+..F.2..M.$..C
02B940:  C2 09 0B CD 40 00 C3 BD 0A FE 56 C2 BD 0A CD 43    ....@.....V....C
02B950:  00 C3 B1 08 CD 08 09 21 2C 0B CD F6 08 21 4A 0B    .......!,....!J.
02B960:  CD F6 08 21 69 0B CD F6 08 C3 BD 0A 0B 1B 47 68    ...!i.........Gh
02B970:  6F 75 6C 27 73 20 57 72 69 74 65 72 20 4C 69 6E    oul's Writer Lin
02B980:  6B 65 72 20 20 76 31 2E 30 00 0D 1A 43 6F 64 65    ker  v1.0...Code
02B990:  64 20 62 79 20 54 6F 6D 20 65 74 20 4A 65 72 72    d by Tom et Jerr
02B9A0:  79 20 6F 66 20 47 50 41 00 0F 1A 54 68 69 73 20    y of GPA...This 
02B9B0:  70 72 6F 67 72 61 6D 20 69 73 20 73 68 61 72 65    program is share
02B9C0:  77 61 72 65 20 21 21 00 0E FF 0C D6 0A 30 FB C6    ware !!......0..
02B9D0:  3A 23 77 2B 79 C6 30 77 C9 CD 08 09 CD 2B 09 21    :#w+y.0w.....+.!
02B9E0:  3C 0C CD F6 08 21 0B 08 11 1A 08 01 0C 00 ED B0    <....!..........
02B9F0:  21 18 08 CD AC 0C FE FC 20 06 CD 08 09 C3 BD 0A    !....... .......
02BA00:  21 1D 02 01 05 00 09 E5 E5 DD E1 32 50 00 21 E2    !..........2P.!.
02BA10:  02 4F 06 00 09 CD 5B 01 E1 3A 50 00 3C FE 20 20    .O....[..:P.<.  
02BA20:  E2 C9 3E 20 21 02 03 F5 CD 06 08 F1 23 3D 20 F7    ..> !.......#= .
02BA30:  C9 DD 21 1A 02 18 07 DD 21 1E 02 2A 51 00 7E DD    ..!.....!..*Q.~.
02BA40:  77 00 23 7E DD 77 01 DD E5 E1 CD 06 08 C9 01 07    w.#~.w..........
02BA50:  59 65 73 00 01 07 4E 6F 20 00 01 07 F3 00 01 07    Yes...No .......
02BA60:  20 00 07 01 01 01 02 08 01 01 01 05 09 01 00 00     ...............
02BA70:  01 0B 01 01 00 1A 0C 01 01 00 1A 0D 01 01 00 1A    ................
02BA80:  0E 01 01 00 1A 0F 01 01 00 1A 10 01 01 00 1A 11    ................
02BA90:  01 01 00 1A 12 01 01 00 1A 14 01 01 00 1A 15 01    ................
02BAA0:  01 00 1A 16 01 01 00 1A 18 01 00 00 01 07 28 01    ..............(.
02BAB0:  00 01 08 28 01 00 1A 09 28 01 00 1A 0A 28 01 00    ...(....(....(..
02BAC0:  1A 0B 28 01 00 1A 0C 28 01 00 1A 0D 28 01 00 1A    ..(....(....(...
02BAD0:  0E 28 01 00 1A 0F 28 01 00 1A 10 28 01 00 1A 11    .(....(....(....
02BAE0:  28 01 00 1A 12 28 01 00 1A 13 28 01 00 1A 14 28    (....(....(....(
02BAF0:  01 00 1A 15 28 01 00 1A 16 28 01 00 1A 17 28 01    ....(....(....(.
02BB00:  00 1A 01 04 01 1A 1A 1A 1A 1A 1A 1A 1A 1A 14 00    ................
02BB10:  00 01 00 01 02 03 04 05 06 07 08 09 0A 0B 0C 0D    ................
02BB20:  0E 0F 01 04 01 1A 1A 1A 1A 1A 1A 1A 1A 1A 14 00    ................
02BB30:  00 01 00 01 02 03 04 05 06 07 08 09 0A 0B 0C 0D    ................
02BB40:  0E 0F 07 03 54 65 78 74 20 73 70 65 65 64 00 08    ....Text speed..
02BB50:  03 43 75 72 73 6F 72 20 73 70 65 65 64 00 09 03    .Cursor speed...
02BB60:  43 75 72 73 6F 72 20 76 69 73 69 62 6C 65 00 0B    Cursor visible..
02BB70:  03 54 65 78 74 6C 69 6E 65 20 31 20 63 6F 6C 6F    .Textline 1 colo
02BB80:  72 00 0C 03 54 65 78 74 6C 69 6E 65 20 32 20 63    r...Textline 2 c
02BB90:  6F 6C 6F 72 00 0D 03 54 65 78 74 6C 69 6E 65 20    olor...Textline 
02BBA0:  33 20 63 6F 6C 6F 72 00 0E 03 54 65 78 74 6C 69    3 color...Textli
02BBB0:  6E 65 20 34 20 63 6F 6C 6F 72 00 0F 03 54 65 78    ne 4 color...Tex
02BBC0:  74 6C 69 6E 65 20 35 20 63 6F 6C 6F 72 00 10 03    tline 5 color...
02BBD0:  54 65 78 74 6C 69 6E 65 20 36 20 63 6F 6C 6F 72    Textline 6 color
02BBE0:  00 11 03 54 65 78 74 6C 69 6E 65 20 37 20 63 6F    ...Textline 7 co
02BBF0:  6C 6F 72 00 12 03 54 65 78 74 6C 69 6E 65 20 38    lor...Textline 8
02BC00:  CD 08 09 3A 5A BB 32 27 08 3E C9 32 5A BB 21 1A    ...:Z.2'.>.2Z.!.
02BC10:  08 06 0C 11 00 C0 CD 77 BC 30 40 CD 47 0F A7 C2    .......w.0@.G...
02BC20:  21 0C 21 00 00 CD 83 BC 30 31 CD 7A BC 30 2C 3A    !.!.....01.z.0,:
02BC30:  27 08 32 5A BB CD 08 09 21 90 0C CD F6 08 06 00    '.2Z....!.......
02BC40:  3A 5E 08 4F 0D 21 28 08 09 3E 01 77 79 21 18 08    :^.O.!(..>.wy!..
02BC50:  E5 CD 49 00 E1 CD DB 0E C3 BD 0A 21 7D 0C 22 2E    ..I........!}.".
02BC60:  0C CD 7D BC 3A 27 08 32 5A BB CD 08 09 21 00 00    ..}.:'.2Z....!..
02BC70:  CD F6 08 21 09 08 CD DB 0E C3 BD 0A 07 01 54 79    ...!..........Ty
02BC80:  70 65 20 66 69 6C 65 6E 61 6D 65 20 74 6F 20 6C    pe filename to l
02BC90:  6F 61 64 2C 20 28 52 65 74 75 72 6E 29 20 74 6F    oad, (Return) to
02BCA0:  20 76 61 6C 69 64 61 74 65 2C 20 28 45 73 63 29     validate, (Esc)
02BCB0:  20 74 6F 20 61 62 6F 72 74 20 3A 20 00 07 01 4C     to abort : ...L
02BCC0:  6F 61 64 69 6E 67 20 65 72 72 6F 72 2E 2E 2E 00    oading error....
02BCD0:  07 01 46 69 6C 65 20 6C 6F 61 64 65 64 20 73 75    ..File loaded su
02BCE0:  63 63 65 73 66 75 6C 6C 79 2E 00 01 22 C1 0C 23    ccesfully..."..#
02BCF0:  23 E5 D1 13 01 07 00 36 20 ED B0 3E 01 32 AB 0C    #......6 ..>.2..
02BD00:  21 00 00 E5 CD F6 08 E1 23 CD 18 BB FE FC C8 FE    !.......#.......
02BD10:  0D C8 FE 8B C8 FE 7F 28 36 5F 06 0F DD 21 61 08    .......(6_...!a.
02BD20:  DD 7E 00 BB 28 DA DD 23 10 F6 7B D6 7B 30 D1 7B    .~..(..#..{.{0.{
02BD30:  D6 61 38 04 7B E6 DF 5F 7B D6 20 38 C3 3A AB 0C    .a8.{.._{. 8.:..
02BD40:  FE 09 28 BC 4F 3C 32 AB 0C 06 00 09 73 18 B1 3A    ..(.O<2.....s..:
02BD50:  AB 0C FE 01 28 AA 3D 4F 06 00 09 36 20 32 AB 0C    ....(.=O...6 2..
02BD60:  18 9E 21 E1 0D CD 34 0D CD 08 09 21 3D 08 CD DB    ..!...4....!=...
02BD70:  0E C3 BD 0A E5 CD 08 09 CD 00 07 E1 CD F6 08 21    ...............!
02BD80:  30 08 11 3F 08 01 0C 00 ED B0 21 3D 08 CD AC 0C    0..?......!=....
02BD90:  C9 CD 46 00 A7 20 0C CD 08 09 21 8D 0E CD F6 08    ..F.. ....!.....
02BDA0:  C3 BD 0A CD 03 07 21 21 0E CD 34 0D FE FC 20 06    ......!!..4... .
02BDB0:  CD 08 09 C3 BD 0A 3A 3F 08 FE 20 20 0C CD 08 09    ......:?..  ....
02BDC0:  21 A3 0E CD F6 08 C3 BD 0A CD 4C 00 3A 5A BB 32    !£........L.:Z.2
02BDD0:  27 08 3E C9 32 5A BB 21 3F 08 06 08 11 00 C0 CD    '.>.2Z.!?.......
02BDE0:  8C BC 30 27 2A 72 08 E5 2A 70 08 D1 01 00 90 3E    ..0'*r..*p.....>
02BDF0:  02 CD 98 BC 30 16 CD 8F BC 3A 27 08 32 5A BB CD    ....0....:'.2Z..
02BE00:  20 63 6F 6C 6F 72 00 14 03 43 6F 6C 6F 72 20 46     color...Color F
02BE10:  78 00 15 03 52 6F 64 73 20 63 6F 6C 6F 72 00 16    x...Rods color..
02BE20:  03 50 61 70 65 72 20 74 65 78 74 20 63 6F 6C 6F    .Paper text colo
02BE30:  72 00 18 03 53 70 61 63 65 20 6D 65 73 73 61 67    r...Space messag
02BE40:  65 00 07 2A 4C 6F 67 6F 20 6D 6F 64 65 00 08 2A    e..*Logo mode..*
02BE50:  4C 6F 67 6F 20 63 6F 6C 6F 72 20 30 00 09 2A 4C    Logo color 0..*L
02BE60:  6F 67 6F 20 63 6F 6C 6F 72 20 31 00 0A 2A 4C 6F    ogo color 1..*Lo
02BE70:  67 6F 20 63 6F 6C 6F 72 20 32 00 0B 2A 4C 6F 67    go color 2..*Log
02BE80:  6F 20 63 6F 6C 6F 72 20 33 00 0C 2A 4C 6F 67 6F    o color 3..*Logo
02BE90:  20 63 6F 6C 6F 72 20 34 00 0D 2A 4C 6F 67 6F 20     color 4..*Logo 
02BEA0:  63 6F 6C 6F 72 20 35 00 0E 2A 4C 6F 67 6F 20 63    color 5..*Logo c
02BEB0:  6F 6C 6F 72 20 36 00 0F 2A 4C 6F 67 6F 20 63 6F    olor 6..*Logo co
02BEC0:  6C 6F 72 20 37 00 10 2A 4C 6F 67 6F 20 63 6F 6C    lor 7..*Logo col
02BED0:  6F 72 20 38 00 11 2A 4C 6F 67 6F 20 63 6F 6C 6F    or 8..*Logo colo
02BEE0:  72 20 39 00 12 2A 4C 6F 67 6F 20 63 6F 6C 6F 72    r 9..*Logo color
02BEF0:  20 31 30 00 13 2A 4C 6F 67 6F 20 63 6F 6C 6F 72     10..*Logo color
02BF00:  20 31 31 00 14 2A 4C 6F 67 6F 20 63 6F 6C 6F 72     11..*Logo color
02BF10:  20 31 32 00 15 2A 4C 6F 67 6F 20 63 6F 6C 6F 72     12..*Logo color
02BF20:  20 31 33 00 16 2A 4C 6F 67 6F 20 63 6F 6C 6F 72     13..*Logo color
02BF30:  20 31 34 00 17 2A 4C 6F 67 6F 20 63 6F 6C 6F 72     14..*Logo color
02BF40:  20 31 35 00 07 01 4D 75 73 69 63 20 66 69 6C 65     15...Music file
02BF50:  00 08 01 4C 6F 67 6F 20 66 69 6C 65 00 09 01 46    ...Logo file...F
02BF60:  6F 6E 74 20 66 69 6C 65 00 0A 01 54 65 78 74 20    ont file...Text 
02BF70:  66 69 6C 65 00 0B 01 66 78 20 31 20 66 69 6C 65    file...fx 1 file
02BF80:  00 0C 01 66 78 20 32 20 66 69 6C 65 00 CD 03 08    ...fx 2 file....
02BF90:  21 04 05 3E 06 F5 CD 06 08 F1 23 3D 20 F7 21 53    !..>......#= .!S
02BFA0:  00 3E 06 F5 CD 06 08 F1 23 3D 20 F7 C9 0E 01 56    .>......#= ....V
02BFB0:  69 65 77 20 61 62 6F 72 74 65 64 2E 2E 2E 00 0E    iew aborted.....
02BFC0:  01 50 72 65 73 73 20 61 6E 79 20 6B 65 79 20 74    .Press any key t
02BFD0:  6F 20 73 74 61 72 74 2C 20 28 45 73 63 29 20 74    o start, (Esc) t
02BFE0:  6F 20 61 62 6F 72 74 2E 00 54 44 55 5C 58 5D 4C    o abort..TDU\X]L
02BFF0:  48 4D 56 46 57 5E 40 5F 4E 47 4F 52 42 53 5A 59    HMVFW^@_NGORBSZY
02C000:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
02C010:  25 00 01 00 02 09 4E E5 25 00 C1 02 00 00 00 02    %.....N.%.......
02C020:  25 00 C6 02 00 00 00 02 25 00 C2 02 00 00 00 02    %.......%.......
02C030:  25 00 C7 02 00 00 00 02 25 00 C3 02 00 00 00 02    %.......%.......
02C040:  25 00 C8 02 00 00 00 02 25 00 C4 02 00 00 00 02    %.......%.......
02C050:  25 00 C9 02 00 00 00 02 25 00 C5 02 00 00 00 02    %.......%.......
02C060:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02C070:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02C080:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02C090:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02C0A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02C0B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02C0C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02C0D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02C0E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02C0F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02C100:  08 09 21 73 0E CD F6 08 C3 BD 0A E1 CD 92 BC 3A    ..!s...........:
02C110:  27 08 32 5A BB CD 08 09 21 61 0E CD F6 08 C3 BD    '.2Z....!a......
02C120:  0A 07 01 54 79 70 65 20 66 69 6C 65 6E 61 6D 65    ...Type filename
02C130:  20 74 6F 20 6C 6F 61 64 2C 20 28 52 65 74 75 72     to load, (Retur
02C140:  6E 29 20 74 6F 20 76 61 6C 69 64 61 74 65 2C 20    n) to validate, 
02C150:  28 45 73 63 29 20 74 6F 20 61 62 6F 72 74 20 3A    (Esc) to abort :
02C160:  00 07 01 54 79 70 65 20 66 69 6C 65 6E 61 6D 65    ...Type filename
02C170:  20 74 6F 20 73 61 76 65 2C 20 28 52 65 74 75 72     to save, (Retur
02C180:  6E 29 20 54 6F 20 76 61 6C 69 64 61 74 65 2C 20    n) To validate, 
02C190:  28 45 73 63 29 20 74 6F 20 61 62 6F 72 74 20 3A    (Esc) to abort :
02C1A0:  00 07 01 53 61 76 69 6E 67 20 65 72 72 6F 72 2E    ...Saving error.
02C1B0:  2E 2E 00 07 01 46 69 6C 65 20 73 61 76 65 64 20    .....File saved 
02C1C0:  73 75 63 63 65 73 66 75 6C 6C 79 2E 00 07 01 4E    succesfully....N
02C1D0:  6F 20 69 6E 74 72 6F 20 74 6F 20 73 61 76 65 2E    o intro to save.
02C1E0:  2E 2E 00 07 01 45 72 72 6F 72 2E 2E 2E 20 46 69    .....Error... Fi
02C1F0:  6C 65 20 68 61 73 20 6E 6F 20 6E 61 6D 65 2E 00    le has no name..
02C200:  AF 32 00 A7 21 09 08 CD DB 0E C3 BD 0A 3E 01 32    .2..!........>.2
02C210:  00 A7 21 09 08 CD DB 0E C3 BD 0A 3A 00 A7 C6 41    ..!........:...A
02C220:  32 AE 0A 23 23 11 B0 0A 01 0C 00 ED B0 21 A3 0A    2..##........!£.
02C230:  CD F6 08 C9 3E 04 21 55 08 32 5E 08 22 5F 08 11    ....>.!U.2^."_..
02C240:  14 08 01 03 00 E5 ED B0 E1 E5 11 93 09 01 03 00    ................
02C250:  ED B0 E1 11 14 08 01 03 00 ED B0 21 09 08 CD F6    ...........!....
02C260:  08 C3 BD 0A 3E 01 21 4C 08 18 CE 3E 02 21 52 08    ....>.!L...>.!R.
02C270:  18 C7 3E 03 21 4F 08 18 C0 3E 05 21 58 08 18 B9    ..>.!O...>.!X...
02C280:  3E 06 21 5B 08 18 B2 3A 5E 08 FE 01 20 28 21 00    >.![...:^... (!.
02C290:  1D CD 3E 10 A7 C2 1F 10 21 00 60 CD 49 10 A7 C2    ..>.....!.`.I...
02C2A0:  27 10 21 00 60 E5 11 01 60 01 FF 1C 36 00 ED B0    '.!.`...`...6...
02C2B0:  E1 22 E3 0B AF C9 FE 02 20 16 21 E0 0D CD 31 10    ."...... .!...1.
02C2C0:  A7 C2 2C 10 21 00 7E E5 11 01 7E 01 DF 0D 18 DC    ..,.!.~...~.....
02C2D0:  FE 03 20 16 21 00 03 CD 31 10 A7 C2 2C 10 21 F0    .. .!...1...,.!.
02C2E0:  8B E5 11 F1 8B 01 FF 02 18 C2 FE 04 20 35 21 F3    ............ 5!.
02C2F0:  11 CD 49 10 A7 20 70 21 0C 4E CD 3E 10 20 60 21    ..I.. p!.N.>. `!
02C300:  00 4D 4F 52 45 20 20 20 20 44 41 54 00 00 00 00    .MORE    DAT....
02C310:  00 00 02 00 00 00 90 00 50 00 00 00 00 00 00 00    ........P.......
02C320:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02C330:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02C340:  50 00 00 BE 03 6C FE FE FE 7C 38 10 00 18 1C 1E    P....l...|8.....
02C350:  1B 18 78 F8 70 38 44 BA A2 BA 44 38 00 18 3C 7E    ..x.p8D...D8..<~
02C360:  FF 18 18 18 18 18 18 18 18 FF 7E 3C 18 10 30 70    ..........~<..0p
02C370:  FF FF 70 30 10 08 0C 0E FF FF 0E 0C 08 00 7E 7E    ..p0..........~~
02C380:  6C FE FE FE 7C 38 10 00 18 1C 1E 1B 18 78 F8 70    l...|8.......x.p
02C390:  38 44 BA A2 BA 44 38 00 18 3C 7E FF 18 18 18 18    8D...D8..<~.....
02C3A0:  18 18 18 18 FF 7E 3C 18 10 30 70 FF FF 70 30 10    .....~<..0p..p0.
02C3B0:  08 0C 0E FF FF 0E 0C 08 00 7E 7E 7E 7E 7E 7E 00    .........~~~~~~.
02C3C0:  10 10 FE 7C 38 6C 82 00 00 7E 42 42 42 42 7E 00    ...|8l...~BBBB~.
02C3D0:  1A 00 00 E2 2C 1C 00 90 2C 0D 00 00 61 64 F2 F5    ....,...,...ad..
02C3E0:  1C 00 90 00 17 00 5A 00 8A 01 BF 20 FF 73 28 0D    ......Z.... .s(.
02C3F0:  00 00 61 64 F2 F5 1C 00 90 29 00 00 00 1A 00 00    ..ad.....)......
02C400:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02C410:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02C420:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02C430:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02C440:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02C450:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02C460:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02C470:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02C480:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02C490:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02C4A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02C4B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02C4C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02C4D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02C4E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02C4F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02C500:  00 60 7D 91 30 01 25 6F 7C 90 67 22 70 08 E5 01    .`}.0.%o|.g"p...
02C510:  FF 5F 79 95 30 01 05 4F 78 94 47 E1 5D 54 E5 13    ._y.0..Ox.G.]T..
02C520:  C3 6C 0F FE 05 20 16 21 91 00 CD 31 10 A7 20 3C    .l... .!...1.. <
02C530:  21 60 8F E5 11 61 8F 01 90 00 C3 6C 0F 21 00 0C    !`...a.....l.!..
02C540:  CD 3E 10 A7 20 19 21 00 96 CD 49 10 A7 20 18 21    .>.. .!...I.. .!
02C550:  00 96 E5 11 01 96 01 FF 0B C3 6C 0F 3E FF C9 21    ..........l.>..!
02C560:  53 10 22 2E 0C 18 F5 21 69 10 18 F6 21 7F 10 18    S."....!i...!...
02C570:  F1 7C B8 20 06 7D B9 20 02 AF C9 3E FF C9 7D 91    .|. .}. ...>..}.
02C580:  30 01 25 7C 90 38 F4 AF C9 7B BD 20 EE 7A BC 20    0.%|.8...{. .z. 
02C590:  EA AF C9 07 01 46 69 6C 65 20 69 73 20 74 6F 6F    .....File is too
02C5A0:  20 6C 6F 6E 67 2E 2E 2E 00 07 01 42 61 64 20 73     long......Bad s
02C5B0:  74 61 72 74 20 61 64 72 65 73 73 2E 2E 2E 00 07    tart adress.....
02C5C0:  01 42 61 64 20 6C 65 6E 67 74 68 2E 2E 2E 00 00    .Bad length.....
02C5D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02C5E0:  1A 65 5F 65 64 69 74 5F 74 65 78 74 20 65 71 75    .e_edit_text equ
02C5F0:  20 26 31 31 46 33 0D 0A 0D 0A 66 69 6E 5F 69 6E     &11F3....fin_in
02C600:  AF 32 00 A7 21 09 08 CD DB 0E C3 BD 0A 3E 01 32    .2..!........>.2
02C610:  00 A7 21 09 08 CD DB 0E C3 BD 0A 3A 00 A7 C6 41    ..!........:...A
02C620:  32 AE 0A 23 23 11 B0 0A 01 0C 00 ED B0 21 A3 0A    2..##........!£.
02C630:  CD F6 08 C9 3E 04 21 55 08 32 5E 08 22 5F 08 11    ....>.!U.2^."_..
02C640:  14 08 01 03 00 E5 ED B0 E1 E5 11 93 09 01 03 00    ................
02C650:  ED B0 E1 11 14 08 01 03 00 ED B0 21 09 08 CD F6    ...........!....
02C660:  08 C3 BD 0A 3E 01 21 4C 08 18 CE 3E 02 21 52 08    ....>.!L...>.!R.
02C670:  18 C7 3E 03 21 4F 08 18 C0 3E 05 21 58 08 18 B9    ..>.!O...>.!X...
02C680:  3E 06 21 5B 08 18 B2 3A 5E 08 FE 01 20 28 21 00    >.![...:^... (!.
02C690:  1D CD 3E 10 A7 C2 1F 10 21 00 60 CD 49 10 A7 C2    ..>.....!.`.I...
02C6A0:  27 10 21 00 60 E5 11 01 60 01 FF 1C 36 00 ED B0    '.!.`...`...6...
02C6B0:  E1 22 E3 0B AF C9 FE 02 20 16 21 E0 0D CD 31 10    ."...... .!...1.
02C6C0:  A7 C2 2C 10 21 00 7E E5 11 01 7E 01 DF 0D 18 DC    ..,.!.~...~.....
02C6D0:  FE 03 20 16 21 00 03 CD 31 10 A7 C2 2C 10 21 F0    .. .!...1...,.!.
02C6E0:  8B E5 11 F1 8B 01 FF 02 18 C2 FE 04 20 35 21 F3    ............ 5!.
02C6F0:  11 CD 49 10 A7 20 70 21 0C 4E CD 3E 10 20 60 21    ..I.. p!.N.>. `!
02C700:  DD 21 4A 28 89 DF 31 21 27 11 18 4F 00 CD 66 BB    .!J(..1!'..O..f.
02C710:  C3 83 8A 44 49 00 D2 00 4C 89 05 4F 89 2A 08 2E    ...DI...L..O.*..
02C720:  47 57 54 27 00 01 01 00 47 68 6F 75 6C 27 73 20    GWT'....Ghoul's 
02C730:  00 57 72 69 74 65 72 20 65 50 64 64 6F 67 20 47    .Writer ePddog G
02C740:  50 41 00 20 28 63 29 20 31 39 39 00 34 00 03 01    PA. (c) 199.4...
02C750:  28 4C 29 6F 10 61 64 20 72 53 29 61 76 40 65 84    (L)o.ad rS)av@e.
02C760:  28 4E 29 65 77 20 93 65 78 74 8B 45 29 6A 94 AA    (N)ew .ext.E)j..
02C770:  72 54 87 62 8B 43 80 6E 85 89 72 74 00 04 7D 48    rT.b.C.n..rt..}H
02C780:  8E 23 6C 70 8B 44 29 69 6D 72 41 46 AE 6C 65 6E    .#lp.D)imrAF.len
02C790:  61 6D 8A 82 72 49 29 6E 66 6F 8B 41 34 29 3A 84    am..rI)nfo.A4):.
02C7A0:  72 42 C2 00 05 3F 01 9A CB CC CD CE CF D0 FE D1    rB...?..........
02C7B0:  D2 D3 D4 D5 CB 57 3A 3B 46 69 B4 C4 C3 20 DE C4    .....W:;Fi... ..
02C7C0:  C0 E1 C4 00 02 3A 50 61 67 E2 B9 DF E4 43 30 31    .....:Pag....C01
02C7D0:  7B 3A 17 4C 69 6E EA 3A 7B ED EF 01 04 3A 43 6F    {:.Lin.:{....:Co
02C7E0:  6C 75 6D 01 00 6E 20 3A 00 04 43 30 31 00 00 CD    lum..n :..C01...
02C7F0:  18 BB E6 DF FE 49 01 CA C7 8A FE 48 CA DF 14 00    .....I.....H....
02C800:  44 CA 21 89 FE 54 CA 84 00 8D FE 4C CA 46 8E FE    D.!..T.....L.F..
02C810:  45 01 CA 88 8F FE 4E CA C5 2C 03 53 CA A7 90 FE    E.....N..,.S....
02C820:  46 20 35 00 43 CA 00 95 FE 41 CA 01 00 92 FE 42    F 5.C....A.....B
02C830:  CA 0B 92 C3 83 00 8A CD A9 88 21 16 8B CD 59 97    ..........!...Y.
02C840:  4D 33 50 52 21 52 55 70 88 48 4A 4C 11 FA 8A 3E    M3PR!RUp.HJL...>
02C850:  00 0E EB 5E 23 56 23 EB D5 40 F5 51 88 F1 D1 3D    ...^#V#..@.Q...=
02C860:  20 F0 80 5B 71 8B 85 8B AB 8B DA 00 8B 09 8C 39     ..[q..........9
02C870:  8C 69 8C 97 00 8C B5 8C D3 8C F3 8C 0F 00 8D 31    .i.............1
02C880:  8D 52 8D 0B 1B 47 00 68 6F 75 6C 27 73 20 57 00    .R...G.houl's W.
02C890:  72 69 74 65 72 20 65 64 A0 9B 6F 9E 76 31 2E 30    riter ed..o.v1.0
02C8A0:  00 04 0D 1A 43 6F 64 A0 20 62 04 79 20 54 6F 6D    ....Cod. b.y Tom
02C8B0:  9F 74 20 50 4A 9D 72 B2 6F 66 20 47 00 50 41 00    .t PJ.r.of G.PA.
02C8C0:  0F 1A 54 68 69 81 97 70 72 6F 67 72 61 B6 80 C9    ..Thi..progra...
02C8D0:  20 73 68 61 72 65 77 80 D6 65 20 21 21 00 07 01     sharew..e !!...
02C8E0:  50 45 A1 74 A3 20 6B 65 79 E0 97 DA 03 00 09 13    PE.t£ key.......
02C8F0:  43 75 3A 72 73 E5 E7 E9 20 F7 2D 0B 20 4D 6F 76    Cu:rs... .-. Mov
02C900:  3A 7B 92 FE FB CA 7C 92 CD 03 60 C3 D5 90 06 04    :{....|...`.....
02C910:  00 10 FD 01 10 7F 3A 03 90 ED 49 ED 79 0E 00 ED    ......:...I.y...
02C920:  49 ED 79 21 F0 FF 23 7C A7 20 FB 3E 54 0E 10 ED    I.y!..#|. .>T...
02C930:  49 ED 79 0E 00 ED 49 ED 79 C9 2A 26 90 7E FE FF    I.y...I.y.*&.~..
02C940:  CA 18 92 23 22 26 90 21 BC C1 01 4A 00 09 D6 08    ...#"&.!...J....
02C950:  30 FB C6 08 01 00 08 A7 28 04 09 3D 20 FC 0E 00    0.......(..= ...
02C960:  3A 18 90 A7 28 02 0E 0F 06 08 7E A1 77 23 7E A1    :...(.....~.w#~.
02C970:  77 23 7E A1 77 23 7E A1 77 23 7E A1 77 23 7E A1    w#~.w#~.w#~.w#~.
02C980:  77 23 7E A1 77 23 7E A1 77 23 7E A1 77 23 10 DA    w#~.w#~.w#~.w#..
02C990:  7E A1 77 23 7E A1 77 C9 AF 32 28 90 32 19 90 21    ~.w#~.w..2(.2..!
02C9A0:  60 8F 22 26 90 C9 3E 30 21 00 7E 11 00 C0 01 4A    `."&..>0!.~....J
02C9B0:  00 ED B0 EB 01 B6 07 09 30 04 01 4A C0 09 EB 3D    ........0..J...=
02C9C0:  20 EC C9 21 7A 92 01 0E F4 ED 49 01 C0 F6 ED 49     ..!z.....I....I
02C9D0:  AF ED 79 01 92 F7 ED 49 0E 45 06 F6 ED 49 06 F4    ..y....I.E...I..
02C9E0:  ED 78 77 23 0E 48 06 F6 ED 49 06 F4 ED 78 77 01    .xw#.H...I...xw.
02C9F0:  82 F7 ED 49 01 00 F6 ED 49 C9 00 00 F3 01 01 BC    ...I....I.......
02CA00:  ED 49 01 28 BD ED 49 01 02 BC ED 49 01 2E BD ED    .I.(..I....I....
02CA10:  49 01 06 BC ED 49 01 19 BD ED 49 01 07 BC ED 49    I....I....I....I
02CA20:  01 1E BD ED 49 01 05 BC ED 49 01 00 BD ED 49 2A    ....I....I....I*
02CA30:  29 90 22 38 00 08 F1 08 CD 9A 93 CD 06 96 FB CD    )."8............
02CA40:  A7 BC C3 00 BB E1 06 2F 10 FE 3E 12 1E 0D 01 01    ......./..>.....
02CA50:  7F DD 21 1A 90 ED 49 08 DD 7E 00 ED 79 00 00 00    ..!...I..~..y...
02CA60:  7B 3D 20 FD DD 7E 01 ED 79 00 00 00 7B 3D 20 FD    {= ..~..y...{= .
02CA70:  DD 7E 02 ED 79 00 00 00 7B 3D 20 FD DD 7E 03 ED    .~..y...{= ..~..
02CA80:  79 00 00 00 7B 3D 20 FD DD 7E 04 ED 79 00 00 00    y...{= ..~..y...
02CA90:  7B 3D 20 FD DD 7E 05 ED 79 00 00 00 7B 3D 20 FD    {= ..~..y...{= .
02CAA0:  DD 7E 06 ED 79 00 00 00 7B 3D 20 FD DD 7E 07 ED    .~..y...{= ..~..
02CAB0:  79 7B 3D 3D 20 FD 08 3D 20 9D 3E 54 ED 79 C3 5D    y{== ..= .>T.y.]
02CAC0:  91 54 54 54 50 50 50 55 55 55 53 53 53 49 49 49    .TTTPPPUUUSSSIII
02CAD0:  4B 4B 4B 4B 4B 4B 49 49 49 53 53 53 55 55 55 50    KKKKKKIIISSSUUUP
02CAE0:  50 50 54 54 54 00 3A 24 90 A7 C8 3A 19 90 FE FF    PPTTT.:$...:....
02CAF0:  20 19 3A 28 90 A7 20 13 2A 98 93 7E A7 20 04 21     .:(.. .*..~. .!
02CB00:  00 4E 4F 20 20 20 20 20 20 4D 55 53 00 00 00 00    .NO      MUS....
02CB10:  00 00 02 00 00 00 60 00 04 00 00 00 00 00 00 00    ......`.........
02CB20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02CB30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02CB40:  04 00 00 BC 02 C9 00 00 C9 1A 20 20 20 20 20 24    ..........     $
02CB50:  24 24 FF 00 FF 00 00 00 00 00 00 00 00 00 00 00    $$..............
02CB60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02CB70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02CB80:  C9 00 00 C9 1A 20 20 20 20 20 24 24 24 FF 00 FF    .....     $$$...
02CB90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02CBA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02CBB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02CBC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02CBD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02CBE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02CBF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02CC00:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02CC10:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02CC20:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02CC30:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02CC40:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02CC50:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02CC60:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02CC70:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02CC80:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02CC90:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02CCA0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02CCB0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02CCC0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02CCD0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02CCE0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02CCF0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02CD00:  00 4C 49 47 48 54 20 20 20 46 4E 54 00 00 00 00    .LIGHT   FNT....
02CD10:  00 00 02 00 00 00 7D 00 00 03 00 7D 00 00 00 00    ......}....}....
02CD20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02CD30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02CD40:  00 03 00 C2 03 00 00 4C 49 47 48 54 20 20 20 24    .......LIGHT   $
02CD50:  24 24 FF 00 FF 00 00 02 00 00 00 7D 00 00 03 00    $$.........}....
02CD60:  7D 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    }...............
02CD70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02CD80:  00 00 00 00 00 00 00 00 08 08 08 08 08 00 08 00    ................
02CD90:  28 28 28 00 00 00 00 00 28 28 FE 28 FE 28 28 00    (((.....((.(.((.
02CDA0:  18 3E 58 3C 1A 7C 18 00 C2 C4 08 10 20 46 86 00    .>X<.|...... F..
02CDB0:  38 44 38 62 94 88 76 00 08 08 10 00 00 00 00 00    8D8b..v.........
02CDC0:  0C 10 20 20 20 10 0C 00 30 08 04 04 04 08 30 00    ..   ...0.....0.
02CDD0:  00 66 3C FF 3C 66 00 00 00 08 08 3E 08 08 00 00    .f<.<f.....>....
02CDE0:  00 00 00 00 00 08 08 10 00 00 00 7E 00 00 00 00    ...........~....
02CDF0:  00 00 00 00 00 18 18 00 02 04 08 10 20 40 80 00    ............ @..
02CE00:  7C 86 8A 92 A2 C2 7C 00 18 28 08 08 08 08 3E 00    |.....|..(....>.
02CE10:  3C 42 02 3C 40 42 7E 00 3C 42 02 0C 02 42 3C 00    <B.<@B~.<B...B<.
02CE20:  18 28 48 88 FC 08 1C 00 7E 40 40 7C 02 42 3C 00    .(H.....~@@|.B<.
02CE30:  3C 42 40 7C 42 42 3C 00 7E 42 02 04 08 08 08 00    <B@|BB<.~B......
02CE40:  3C 42 42 3C 42 42 3C 00 3C 42 42 3E 02 42 3C 00    <BB<BB<.<BB>.B<.
02CE50:  00 00 18 18 00 18 18 00 00 00 18 18 00 08 08 10    ................
02CE60:  08 10 20 40 20 10 08 00 00 00 7E 00 00 7E 00 00    .. @ .....~..~..
02CE70:  20 10 08 04 08 10 20 00 3C 42 42 04 08 00 18 00     ..... .<BB.....
02CE80:  20 10 38 04 3C 44 3A 00 3C 42 42 42 7E 42 42 00     .8.<D:.<BBB~BB.
02CE90:  FC 42 42 7C 42 42 FC 00 3C 42 80 80 80 42 3C 00    .BB|BB..<B...B<.
02CEA0:  F8 44 42 42 42 42 FC 00 FE 42 40 70 40 42 FE 00    .DBBBB...B@p@B..
02CEB0:  FE 42 40 70 40 40 F0 00 7C 82 80 8E 82 82 7C 00    .B@p@@..|.....|.
02CEC0:  42 42 42 7E 42 42 42 00 38 10 10 10 10 10 38 00    BBB~BBB.8.....8.
02CED0:  1E 04 04 04 84 84 78 00 C2 42 44 78 44 42 C2 00    ......x..BDxDB..
02CEE0:  E0 40 40 40 40 42 FE 00 C6 EE BA 92 82 82 82 00    .@@@@B..........
02CEF0:  82 C2 A2 92 8A 86 82 00 38 44 82 82 82 44 38 00    ........8D...D8.
02CF00:  65 20 74 6F 20 6C 6F 61 64 2C 20 28 52 65 74 75    e to load, (Retu
02CF10:  72 6E 29 20 74 6F 20 76 61 6C 69 64 61 74 65 2C    rn) to validate,
02CF20:  20 28 45 73 63 29 20 74 6F 20 61 62 6F 72 74 20     (Esc) to abort 
02CF30:  3A 00 07 01 54 79 70 65 20 66 69 6C 65 6E 61 6D    :...Type filenam
02CF40:  65 20 74 6F 20 73 61 76 65 2C 20 28 52 65 74 75    e to save, (Retu
02CF50:  72 6E 29 20 54 6F 20 76 61 6C 69 64 61 74 65 2C    rn) To validate,
02CF60:  20 28 45 73 63 29 20 74 6F 20 61 62 6F 72 74 20     (Esc) to abort 
02CF70:  3A 00 07 01 53 61 76 69 6E 67 20 65 72 72 6F 72    :...Saving error
02CF80:  2E 2E 2E 00 07 01 46 69 6C 65 20 73 61 76 65 64    ......File saved
02CF90:  20 73 75 63 63 65 73 66 75 6C 6C 79 2E 00 07 01     succesfully....
02CFA0:  4E 6F 20 74 65 78 74 20 74 6F 20 73 61 76 65 2E    No text to save.
02CFB0:  2E 2E 00 07 01 45 72 72 6F 72 2E 2E 2E 20 46 69    .....Error... Fi
02CFC0:  6C 65 20 68 61 73 20 6E 6F 20 6E 61 6D 65 2E 00    le has no name..
02CFD0:  AF 32 00 A7 CD A5 0E C3 A5 0A 3E 01 32 00 A7 CD    .2........>.2...
02CFE0:  A5 0E C3 A5 0A 21 8B 0A 3A 00 A7 C6 41 32 96 0A    .....!..:...A2..
02CFF0:  CD E1 08 C9 3E 04 21 55 08 32 5E 08 22 5F 08 11    ....>.!U.2^."_..
02D000:  14 08 01 03 00 E5 ED B0 E1 E5 11 7B 09 01 03 00    ...........{....
02D010:  ED B0 E1 11 14 08 01 03 00 ED B0 21 09 08 CD E1    ...........!....
02D020:  08 C3 A5 0A 3E 01 21 4C 08 18 CE 3E 02 21 52 08    ....>.!L...>.!R.
02D030:  18 C7 3E 03 21 4F 08 18 C0 3E 05 21 58 08 18 B9    ..>.!O...>.!X...
02D040:  3E 06 21 5B 08 18 B2 3A 5E 08 FE 01 20 27 21 00    >.![...:^... '!.
02D050:  1D CD E6 0F A7 C2 C7 0F 21 00 60 CD F1 0F A7 C2    ........!.`.....
02D060:  CF 0F 21 00 60 E5 11 01 60 01 FF 1C 36 00 ED B0    ..!.`...`...6...
02D070:  E1 22 CB 0B C9 FE 02 20 16 21 E0 0D CD D9 0F A7    ."..... .!......
02D080:  C2 D4 0F 21 00 7E E5 11 01 7E 01 DF 0D 18 DD FE    ...!.~...~......
02D090:  03 20 16 21 00 03 CD D9 0F A7 C2 D4 0F 21 F0 8B    . .!.........!..
02D0A0:  E5 11 F1 8B 01 FF 02 18 C3 FE 04 20 1E 21 F3 11    ........... .!..
02D0B0:  CD F1 0F A7 20 59 21 0C 4E CD E6 0F 20 49 21 F3    .... Y!.N... I!.
02D0C0:  11 E5 11 F4 11 01 0B 4E C3 2C 0F FE 05 20 16 21    .......N.,... .!
02D0D0:  91 00 CD D9 0F A7 20 3C 21 60 8F E5 11 61 8F 01    ...... <!`...a..
02D0E0:  90 00 C3 2C 0F 21 00 0C CD E6 0F A7 20 19 21 00    ...,.!...... .!.
02D0F0:  96 CD F1 0F A7 20 18 21 00 96 E5 11 01 96 01 FF    ..... .!........
02D100:  FC 42 42 7C 40 40 E0 00 7C 82 82 82 92 88 76 00    .BB|@@..|.....v.
02D110:  FC 42 42 7C 48 44 C6 00 3C 42 40 3C 02 42 3C 00    .BB|HD..<B@<.B<.
02D120:  FE 92 10 10 10 10 38 00 42 42 42 42 42 42 3C 00    ......8.BBBBBB<.
02D130:  42 42 42 42 42 24 18 00 82 82 82 82 92 AA C6 00    BBBBB$..........
02D140:  82 44 28 10 28 44 82 00 42 42 42 3C 08 08 1C 00    .D(.(D..BBB<....
02D150:  FE 84 08 10 20 42 FE 00 38 20 20 20 20 20 38 00    .... B..8     8.
02D160:  00 00 38 44 40 3C 10 30 1C 04 04 04 04 04 1C 00    ..8D@<.0........
02D170:  18 24 00 00 00 00 00 00 00 00 00 00 00 00 00 FF    .$..............
02D180:  20 10 08 00 00 00 00 00 00 00 38 04 3C 44 3A 00     .........8.<D:.
02D190:  60 20 3C 22 22 22 DC 00 00 00 38 44 40 44 38 00    ` <"""....8D@D8.
02D1A0:  0C 04 3C 44 44 44 3A 00 00 00 38 44 7C 40 3C 00    ..<DDD:...8D|@<.
02D1B0:  1C 22 20 70 20 20 70 00 00 00 3C 44 44 3C 04 38    ." p  p...<DD<.8
02D1C0:  20 20 2C 32 22 22 22 00 30 00 30 10 10 10 38 00      ,2""".0.0...8.
02D1D0:  0C 00 0C 04 04 44 44 38 20 20 22 24 38 24 22 00    .....DD8  "$8$".
02D1E0:  18 08 08 08 08 08 1C 00 00 00 6C 92 92 92 82 00    ..........l.....
02D1F0:  00 00 5C 22 22 22 22 00 00 00 38 44 44 44 38 00    ..\""""...8DDD8.
02D200:  00 00 5C 22 22 3C 20 70 00 00 74 88 88 78 08 1C    ..\""< p..t..x..
02D210:  00 00 5C 22 20 20 70 00 00 00 3C 40 3C 02 7C 00    ..\"  p...<@<.|.
02D220:  20 20 78 20 20 24 18 00 00 00 44 44 44 44 3C 00      x  $....DDDD<.
02D230:  00 00 44 44 44 28 10 00 00 00 82 92 92 92 6C 00    ..DDD(........l.
02D240:  00 00 84 48 30 48 84 00 00 00 44 44 44 3C 04 38    ...H0H....DDD<.8
02D250:  00 00 7E 04 08 10 7E 00 0C 10 38 44 7C 40 3C 00    ..~...~...8D|@<.
02D260:  30 08 44 44 44 44 3C 00 60 10 38 44 7C 40 3C 00    0.DDDD<.`.8D|@<.
02D270:  36 48 00 00 00 00 00 00 3C 42 40 F8 40 42 FE 00    6H......<B@.@B..
02D280:  20 10 38 04 3C 44 3A 00 3C 42 42 42 7E 42 42 00     .8.<D:.<BBB~BB.
02D290:  FC 42 42 7C 42 42 FC 00 3C 42 80 80 80 42 3C 00    .BB|BB..<B...B<.
02D2A0:  F8 44 42 42 42 42 FC 00 FE 42 40 70 40 42 FE 00    .DBBBB...B@p@B..
02D2B0:  FE 42 40 70 40 40 F0 00 7C 82 80 8E 82 82 7C 00    .B@p@@..|.....|.
02D2C0:  42 42 42 7E 42 42 42 00 38 10 10 10 10 10 38 00    BBB~BBB.8.....8.
02D2D0:  1E 04 04 04 84 84 78 00 C2 42 44 78 44 42 C2 00    ......x..BDxDB..
02D2E0:  E0 40 40 40 40 42 FE 00 C6 EE BA 92 82 82 82 00    .@@@@B..........
02D2F0:  82 C2 A2 92 8A 86 82 00 38 44 82 82 82 44 38 00    ........8D...D8.
02D300:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
02D310:  26 00 01 00 02 09 4E E5 26 00 C1 02 00 00 00 02    &.....N.&.......
02D320:  26 00 C6 02 00 00 00 02 26 00 C2 02 00 00 00 02    &.......&.......
02D330:  26 00 C7 02 00 00 00 02 26 00 C3 02 00 00 00 02    &.......&.......
02D340:  26 00 C8 02 00 00 00 02 26 00 C4 02 00 00 00 02    &.......&.......
02D350:  26 00 C9 02 00 00 00 02 26 00 C5 02 00 00 00 02    &.......&.......
02D360:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02D370:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02D380:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02D390:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02D3A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02D3B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02D3C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02D3D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02D3E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02D3F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02D400:  00 52 41 49 4E 20 20 20 20 47 57 58 00 00 00 00    .RAIN    GWX....
02D410:  00 00 02 00 00 00 96 00 20 01 00 96 00 00 00 00    ........ .......
02D420:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02D430:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02D440:  20 01 00 10 04 DD 23 DD 23 08 3D 20 A0 C9 05 05     .....#.#.= ....
02D450:  79 2D 2D 20 69 40 3B 36 8D 1C 11 33 48 02 32 12    y-- i@;6...3H.2.
02D460:  65 1A 00 00 00 1A 00 00 00 00 00 00 00 00 00 00    e...............
02D470:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02D480:  C3 07 96 C3 40 96 C9 21 50 97 11 06 C2 3E 90 73    ....@..!P....>.s
02D490:  23 72 23 EB 01 00 08 09 30 04 01 4A C0 09 EB 3D    #r#.....0..J...=
02D4A0:  20 ED 21 09 97 01 14 00 E5 C5 11 1D 97 ED B0 C1     .!.............
02D4B0:  E1 11 31 97 ED B0 06 08 C5 CD A0 96 C1 10 F9 C9    ..1.............
02D4C0:  3E 0A DD 21 1D 97 16 00 08 01 50 97 DD 6E 00 62    >..!......P..n.b
02D4D0:  29 09 4E 23 46 DD 6E 01 5D 62 09 4E 79 E6 F0 77    ).N#F.n.]b.Ny..w
02D4E0:  79 01 00 08 09 30 04 01 4A C0 09 E6 0F FE 0F 28    y....0..J......(
02D4F0:  08 A7 28 05 17 FE 10 20 0F 1D 7B A7 20 06 3E 49    ..(.... ..{. .>I
02D500:  01 49 00 09 DD 77 01 2B DD 7E 00 3C FE 90 20 05    .I...w.+.~.<.. .
02D510:  7E E6 F0 77 AF DD 77 00 DD 23 DD 23 08 3D 20 A8    ~..w..w..#.#.= .
02D520:  3E 0A DD 21 31 97 16 00 08 01 50 97 DD 6E 00 62    >..!1.....P..n.b
02D530:  29 09 4E 23 46 DD 6E 01 5D 62 09 7E 01 00 08 09    ).N#F.n.]b.~....
02D540:  30 04 01 4A C0 09 E6 0F FE 0F 28 08 A7 28 05 17    0..J......(..(..
02D550:  FE 10 20 16 1D 7B A7 20 06 3E 49 01 49 00 09 DD    .. ..{. .>I.I...
02D560:  77 01 2B 7E E6 F0 3C 77 18 06 4F 7E E6 F0 81 77    w.+~..<w..O~...w
02D570:  DD 7E 00 3C FE 90 20 05 7E E6 F0 77 AF DD 77 00    .~.<.. .~..w..w.
02D580:  DD 23 DD 23 08 3D 20 A0 C9 05 05 79 2D 2D 20 69    .#.#.= ....y-- i
02D590:  40 3B 36 8D 1C 11 33 48 02 32 12 65 1A 00 00 00    @;6...3H.2.e....
02D5A0:  1A 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02D5B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02D5C0:  00 00 00 00 00 1A 0A 0D 0A 4F 52 47 20 26 39 36    .........ORG &96
02D5D0:  30 30 0D 0A 57 52 49 54 45 20 22 52 41 49 4E 2E    00..WRITE "RAIN.
02D5E0:  42 49 4E 22 0D 0A 0D 0A 62 61 73 65 5F 65 63 72    BIN"....base_ecr
02D5F0:  61 6E 20 65 71 75 20 26 43 32 35 30 20 2D 20 37    an equ &C250 - 7
02D600:  08 06 10 08 05 18 04 04 18 01 03 20 08 03 20 02    ........... .. .
02D610:  02 28 08 02 28 02 01 30 08 01 38 01 4A 00 02 4A    .(..(..0..8.J..J
02D620:  08 04 4A 08 08 4A 10 08 4A 18 08 4A 20 08 4A 28    ..J..J..J..J .J(
02D630:  08 4A 30 08 4A 38 04 94 00 02 94 00 01 94 08 08    .J0.J8..........
02D640:  95 10 02 95 18 08 96 20 02 96 20 08 97 28 01 97    ....... .. ..(..
02D650:  28 04 98 30 08 99 30 01 99 38 01 9A 38 02 9B 38    (..0..0..8..8..8
02D660:  02 E6 00 02 E7 00 02 E8 00 02 E9 00 02 EA 00 01    ................
02D670:  A1 38 01 A2 38 08 A4 38 04 A5 38 02 A6 30 01 A7    .8..8..8..8..0..
02D680:  30 08 A9 28 02 AA 20 01 AB 20 04 AD 18 02 AE 10    0..(.. .. ......
02D690:  08 B0 10 02 B1 08 01 B2 00 04 6A 38 01 6B 30 04    ..........j8.k0.
02D6A0:  6D 28 01 6E 20 08 70 18 02 71 18 08 73 10 02 74    m(.n .p..q..s..t
02D6B0:  08 08 76 00 04 2D 38 01 2E 30 08 30 30 02 31 28    ..v..-8..0.00.1(
02D6C0:  01 32 20 04 34 20 02 35 18 01 36 18 08 38 10 04    .2 .4 .5..6..8..
02D6D0:  39 10 02 3A 10 02 3B 08 01 3C 08 01 3D 08 01 3E    9..:..;..<..=..>
02D6E0:  08 01 3F 08 01 40 08 02 41 10 02 42 10 04 43 10    ..?..@..A..B..C.
02D6F0:  08 44 18 01 44 18 04 45 20 08 46 20 02 46 28 08    .D..D..E .F .F(.
02D700:  47 30 02 47 30 01 47 38 08 92 00 02 92 08 02 92    G0.G0.G8........
02D710:  10 01 92 18 FF FF FF 00 00 00 00 00 00 00 00 00    ................
02D720:  1A 01 3F 08 01 40 08 02 41 10 02 42 10 04 43 10    ..?..@..A..B..C.
02D730:  08 44 18 01 44 18 04 45 20 08 46 20 02 46 28 08    .D..D..E .F .F(.
02D740:  47 30 02 47 30 01 47 38 08 92 00 02 92 08 02 92    G0.G0.G8........
02D750:  10 01 92 18 FF FF FF 00 00 00 00 00 00 00 00 00    ................
02D760:  1A 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02D770:  00 00 00 00 00 00 00 00 00 00 00 24 03 00 C2 03    ...........$....
02D780:  1A 01 01 19 01 02 CE 38 04 CD 38 08 CC 38 01 CA    .......8..8..8..
02D790:  30 02 C9 30 04 C8 28 08 C7 28 02 C5 20 04 C4 18    0..0..(..(.. ...
02D7A0:  01 C2 18 02 C1 10 08 C0 08 02 BE 00 04 73 38 01    .............s8.
02D7B0:  71 38 04 70 30 01 6E 28 04 6D 20 01 6B 18 02 6A    q8.p0.n(.m .k..j
02D7C0:  10 08 69 08 02 67 00 08 66 00 01 1A 38 04 19 30    ..i..g..f...8..0
02D7D0:  08 18 28 02 16 28 04 15 20 01 13 18 02 12 18 04    ..(..(.. .......
02D7E0:  11 10 08 10 10 08 0F 10 01 0D 10 02 0C 08 02 0B    ................
02D7F0:  08 02 0A 08 02 09 08 02 08 08 02 07 10 01 06 10    ................
02D800:  00 08 08 00 00 00 00 00 08 08 00 00 00 00 00 08    ................
02D810:  08 00 00 00 00 00 08 08 00 00 00 00 00 08 08 00    ................
02D820:  00 00 00 00 08 08 00 00 00 00 00 08 04 00 00 00    ................
02D830:  00 01 00 04 00 00 00 00 01 00 02 00 00 00 00 02    ................
02D840:  00 02 00 00 00 00 02 00 01 00 00 00 00 04 00 00    ................
02D850:  08 00 00 00 08 00 00 06 00 00 03 00 00 00 01 08    ................
02D860:  00 0C 00 00 00 00 07 0F 00 00 00 00 00 01 0F 0C    ................
02D870:  00 00 00 00 06 00 03 00 00 00 01 08 00 00 0C 00    ................
02D880:  00 02 00 00 00 02 00 00 04 06 00 00 01 00 00 08    ................
02D890:  0C 00 00 00 08 00 08 0C 00 00 00 08 01 01 08 00    ................
02D8A0:  00 00 04 01 01 08 00 00 00 04 02 00 00 00 00 00    ................
02D8B0:  02 02 00 00 00 00 00 02 02 00 00 00 00 00 02 02    ................
02D8C0:  00 00 00 00 00 02 02 00 00 00 00 00 02 02 00 00    ................
02D8D0:  00 00 00 02 02 00 00 00 00 00 02 01 00 00 00 00    ................
02D8E0:  00 04 01 00 00 00 00 00 04 00 08 00 00 00 00 08    ................
02D8F0:  00 08 00 00 00 00 08 00 04 00 00 00 01 00 00 02    ................
02D900:  00 00 00 02 00 00 01 08 00 00 0C 00 00 00 06 00    ................
02D910:  03 00 00 00 00 01 0F 0C 00 00 00 00 00 00 00 00    ................
02D920:  1A 00 00 06 00 03 00 00 00 00 01 0F 0C 00 00 1A    ................
02D930:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02D940:  00 40 00 BE 03 00 00 42 55 4C 4C 45 20 20 20 24    .@.....BULLE   $
02D950:  24 24 FF 00 FF 00 00 02 00 00 00 40 00 00 40 00    $$.........@..@.
02D960:  40 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    @...............
02D970:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02D980:  08 D1 7E 83 77 23 7E 82 77 D1 23 7E 83 77 23 7E    ..~.w#~.w.#~.w#~
02D990:  82 77 D1 23 7E 83 77 23 7E 82 77 D1 23 7E 83 77    .w.#~.w#~.w.#~.w
02D9A0:  3B 09 30 07 01 4A C0 09 01 FA 07 08 3D 20 D1 ED    ;.0..J......= ..
02D9B0:  7B 34 97 C9 00 00 00 01 00 00 00 C0 00 00 07 0F    {4..............
02D9C0:  00 00 00 00 01 08 00 0C 00 00 00 06 00 00 03 00    ................
02D9D0:  00 00 08 00 00 00 08 00 01 01 08 00 00 04 00 02    ................
02D9E0:  03 00 00 00 02 00 02 03 00 00 00 02 00 04 06 00    ................
02D9F0:  00 00 01 00 04 06 00 00 00 01 00 08 00 00 00 00    ................
02DA00:  00 55 50 44 20 20 20 20 20 42 49 4E 00 00 00 00    .UPD     BIN....
02DA10:  00 00 02 00 00 00 90 00 91 00 00 00 00 00 00 00    ................
02DA20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02DA30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02DA40:  91 00 00 16 04 80 0F 82 0D 84 0B 86 09 88 07 8A    ................
02DA50:  05 8C 03 8E 01 FF 1A 00 00 00 00 00 00 00 00 00    ................
02DA60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02DA70:  00 00 00 00 00 00 DB 00 00 27 05 02 70 01 70 01    .........'..p.p.
02DA80:  00 8F 02 8D 04 8B 06 89 08 87 0A 85 0C 83 0E 81    ................
02DA90:  10 7F 12 7D 14 7B 16 79 18 77 1A 75 1C 73 1E 71    ...}.{.y.w.u.s.q
02DAA0:  20 6F 22 6D 24 6B 26 69 28 67 2A 65 2C 63 2E 61     o"m$k&i(g*e,c.a
02DAB0:  30 5F 32 5D 34 5B 36 59 38 57 3A 55 3C 53 3E 51    0_2]4[6Y8W:U<S>Q
02DAC0:  40 4F 42 4D 44 4B 46 49 48 47 4A 45 4C 43 4E 41    @OBMDKFIHGJELCNA
02DAD0:  50 3F 52 3D 54 3B 56 39 58 37 5A 35 5C 33 5E 31    P?R=T;V9X7Z5\3^1
02DAE0:  60 2F 62 2D 64 2B 66 29 68 27 6A 25 6C 23 6E 21    `/b-d+f)h'j%l#n!
02DAF0:  70 1F 72 1D 74 1B 76 19 78 17 7A 15 7C 13 7E 11    p.r.t.v.x.z.|.~.
02DB00:  80 0F 82 0D 84 0B 86 09 88 07 8A 05 8C 03 8E 01    ................
02DB10:  FF 1A 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02DB20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02DB30:  00 DB 00 00 27 05 02 70 01 70 01 00 55 50 2D 44    ....'..p.p..UP-D
02DB40:  4F 57 4E 20 42 41 53 00 00 00 00 00 00 00 00 00    OWN BAS.........
02DB50:  70 01 00 BA 00 00 00 00 00 00 00 00 00 00 00 00    p...............
02DB60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02DB70:  00 00 00 00 00 00 00 00 00 00 00 BA 00 00 E5 04    ................
02DB80:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02DB90:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02DBA0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02DBB0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02DBC0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02DBD0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02DBE0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02DBF0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02DC00:  00 53 49 4E 55 53 20 20 20 47 57 58 00 00 00 00    .SINUS   GWX....
02DC10:  00 00 02 00 00 00 96 00 B0 02 00 00 00 00 00 00    ................
02DC20:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02DC30:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02DC40:  B0 02 00 E4 04 47 30 02 47 30 01 47 38 08 92 00    .....G0.G0.G8...
02DC50:  02 92 08 02 92 10 01 92 18 FF FF FF 00 00 00 00    ................
02DC60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02DC70:  00 00 00 00 00 1A 44 18 01 44 18 04 45 20 08 46    ......D..D..E .F
02DC80:  C3 07 96 C3 08 96 C9 C9 3E 0A 21 AC 96 08 5E 23    ........>.!...^#
02DC90:  56 23 E5 EB 23 5E 23 56 EB 01 BC E1 09 30 04 01    V#..#^#V.....0..
02DCA0:  4A C0 09 7E E6 F0 77 E1 08 3D 20 E1 3E 0A 21 AC    J..~..w..= .>.!.
02DCB0:  96 08 5E 23 56 13 13 13 2B 1A FE FF 20 03 11 C0    ..^#V...+... ...
02DCC0:  96 73 23 72 23 E5 EB 7E 23 5E 23 56 EB 01 BC E1    .s#r#..~#^#V....
02DCD0:  09 30 04 01 4A C0 09 4F 7E E6 F0 81 77 E1 08 3D    .0..J..O~...w..=
02DCE0:  20 CF 2A 4E 96 22 1A 96 3A AB 96 A7 20 07 3E 3C     .*N."..:... .><
02DCF0:  32 81 96 18 09 FE 80 20 05 3E 3D 32 81 96 3A AB    2...... .>=2..:.
02DD00:  96 3C 32 AB 96 3A 81 96 FE 3C 20 0E 01 00 08 09    .<2..:...< .....
02DD10:  30 04 01 4A C0 09 22 4E 96 C9 01 00 F8 09 7C D6    0..J.."N......|.
02DD20:  C0 30 04 01 B6 3F 09 22 4E 96 C9 01 C0 96 CC 96    .0...?."N.......
02DD30:  D8 96 E4 96 F0 96 FC 96 08 97 14 97 20 97 2C 97    ............ .,.
02DD40:  08 93 20 01 92 28 01 92 30 02 92 38 02 DC 00 04    .. ..(..0..8....
02DD50:  DC 08 01 DB 10 02 DB 10 08 DB 18 02 DA 20 08 DA    ............. ..
02DD60:  28 02 D9 28 01 D8 30 08 D8 30 04 D7 38 02 D6 38    (..(..0..0..8..8
02DD70:  01 D5 38 01 1E 01 01 1D 01 01 1C 01 01 1B 01 01    ..8.............
02DD80:  1A 01 01 19 01 02 CE 38 04 CD 38 08 CC 38 01 CA    .......8..8..8..
02DD90:  30 02 C9 30 04 C8 28 08 C7 28 02 C5 20 04 C4 18    0..0..(..(.. ...
02DDA0:  01 C2 18 02 C1 10 08 C0 08 02 BE 00 04 73 38 01    .............s8.
02DDB0:  71 38 04 70 30 01 6E 28 04 6D 20 01 6B 18 02 6A    q8.p0.n(.m .k..j
02DDC0:  10 08 69 08 02 67 00 08 66 00 01 1A 38 04 19 30    ..i..g..f...8..0
02DDD0:  08 18 28 02 16 28 04 15 20 01 13 18 02 12 18 04    ..(..(.. .......
02DDE0:  11 10 08 10 10 08 0F 10 01 0D 10 02 0C 08 02 0B    ................
02DDF0:  08 02 0A 08 02 09 08 02 08 08 02 07 10 01 06 10    ................
02DE00:  07 01 54 79 70 65 20 66 69 6C 65 6E 61 6D 65 20    ..Type filename 
02DE10:  74 6F 20 6C 6F 61 64 2C 20 28 52 65 74 75 72 6E    to load, (Return
02DE20:  29 20 74 6F 20 76 61 6C 69 64 61 74 65 2C 20 28    ) to validate, (
02DE30:  45 73 63 29 20 74 6F 20 61 62 6F 72 74 20 3A 00    Esc) to abort :.
02DE40:  07 01 54 79 70 65 20 66 69 6C 65 6E 61 6D 65 20    ..Type filename 
02DE50:  74 6F 20 73 61 76 65 2C 20 28 52 65 74 75 72 6E    to save, (Return
02DE60:  29 20 54 6F 20 76 61 6C 69 64 61 74 65 2C 20 28    ) To validate, (
02DE70:  45 73 63 29 20 74 6F 20 61 62 6F 72 74 20 3A 00    Esc) to abort :.
02DE80:  07 01 53 61 76 69 6E 67 20 65 72 72 6F 72 2E 2E    ..Saving error..
02DE90:  2E 00 07 01 46 69 6C 65 20 73 61 76 65 64 20 73    ....File saved s
02DEA0:  75 63 63 65 73 66 75 6C 6C 79 2E 00 07 01 4E 6F    uccesfully....No
02DEB0:  20 74 65 78 74 20 74 6F 20 73 61 76 65 2E 2E 2E     text to save...
02DEC0:  00 07 01 45 72 72 6F 72 2E 2E 2E 20 46 69 6C 65    ...Error... File
02DED0:  20 68 61 73 20 6E 6F 20 6E 61 6D 65 2E 00 AF 32     has no name...2
02DEE0:  00 A7 21 0B 08 CD B9 0E C3 AC 0A 3E 01 32 00 A7    ..!........>.2..
02DEF0:  21 0B 08 CD B9 0E C3 AC 0A 3A 00 A7 C6 41 32 9D    !........:...A2.
02DF00:  0A 23 23 11 9F 0A 01 0C 00 ED B0 21 92 0A CD E5    .##........!....
02DF10:  08 C9 3E 04 21 55 08 32 5E 08 22 5F 08 11 14 08    ..>.!U.2^."_....
02DF20:  01 03 00 E5 ED B0 E1 E5 11 82 09 01 03 00 ED B0    ................
02DF30:  E1 11 14 08 01 03 00 ED B0 21 09 08 CD E5 08 C3    .........!......
02DF40:  AC 0A 3E 01 21 4C 08 18 CE 3E 02 21 52 08 18 C7    ..>.!L...>.!R...
02DF50:  3E 03 21 4F 08 18 C0 3E 05 21 58 08 18 B9 3E 06    >.!O...>.!X...>.
02DF60:  21 5B 08 18 B2 3A 5E 08 FE 01 20 27 21 00 1D CD    ![...:^... '!...
02DF70:  04 10 A7 C2 E5 0F 21 00 60 CD 0F 10 A7 C2 ED 0F    ......!.`.......
02DF80:  21 00 60 E5 11 01 60 01 FF 1C 36 00 ED B0 E1 22    !.`...`...6...."
02DF90:  D2 0B C9 FE 02 20 16 21 E0 0D CD F7 0F A7 C2 F2    ..... .!........
02DFA0:  0F 21 00 7E E5 11 01 7E 01 DF 0D 18 DD FE 03 20    .!.~...~....... 
02DFB0:  16 21 00 03 CD F7 0F A7 C2 F2 0F 21 F0 8B E5 11    .!.........!....
02DFC0:  F1 8B 01 FF 02 18 C3 FE 04 20 1E 21 F3 11 CD 0F    ......... .!....
02DFD0:  10 A7 20 59 21 0C 4E CD 04 10 20 49 21 F3 11 E5    .. Y!.N... I!...
02DFE0:  11 F4 11 01 0B 4E C3 4A 0F FE 05 20 16 21 91 00    .....N.J... .!..
02DFF0:  CD F7 0F A7 20 3C 21 60 8F E5 11 61 8F 01 90 00    .... <!`...a....
02E000:  08 06 10 08 05 18 04 04 18 01 03 20 08 03 20 02    ........... .. .
02E010:  02 28 08 02 28 02 01 30 08 01 38 01 4A 00 02 4A    .(..(..0..8.J..J
02E020:  08 04 4A 08 08 4A 10 08 4A 18 08 4A 20 08 4A 28    ..J..J..J..J .J(
02E030:  08 4A 30 08 4A 38 04 94 00 02 94 00 01 94 08 08    .J0.J8..........
02E040:  95 10 02 95 18 08 96 20 02 96 20 08 97 28 01 97    ....... .. ..(..
02E050:  28 04 98 30 08 99 30 01 99 38 01 9A 38 02 9B 38    (..0..0..8..8..8
02E060:  02 E6 00 02 E7 00 02 E8 00 02 E9 00 02 EA 00 01    ................
02E070:  A1 38 01 A2 38 08 A4 38 04 A5 38 02 A6 30 01 A7    .8..8..8..8..0..
02E080:  30 08 A9 28 02 AA 20 01 AB 20 04 AD 18 02 AE 10    0..(.. .. ......
02E090:  08 B0 10 02 B1 08 01 B2 00 04 6A 38 01 6B 30 04    ..........j8.k0.
02E0A0:  6D 28 01 6E 20 08 70 18 02 71 18 08 73 10 02 74    m(.n .p..q..s..t
02E0B0:  08 08 76 00 04 2D 38 01 2E 30 08 30 30 02 31 28    ..v..-8..0.00.1(
02E0C0:  01 32 20 04 34 20 02 35 18 01 36 18 08 38 10 04    .2 .4 .5..6..8..
02E0D0:  39 10 02 3A 10 02 3B 08 01 3C 08 01 3D 08 01 3E    9..:..;..<..=..>
02E0E0:  08 01 3F 08 01 40 08 02 41 10 02 42 10 04 43 10    ..?..@..A..B..C.
02E0F0:  08 44 18 01 44 18 04 45 20 08 46 20 02 46 28 08    .D..D..E .F .F(.
02E100:  47 30 02 47 30 01 47 38 08 92 00 02 92 08 02 92    G0.G0.G8........
02E110:  10 01 92 18 FF FF FF 00 00 00 00 00 00 00 00 00    ................
02E120:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02E130:  1A 44 18 01 44 18 04 45 20 08 46 20 02 46 28 08    .D..D..E .F .F(.
02E140:  47 30 02 47 30 01 47 38 08 92 00 02 92 08 02 92    G0.G0.G8........
02E150:  10 01 92 18 FF FF FF 00 00 00 00 00 00 00 00 00    ................
02E160:  1A 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02E170:  00 00 00 00 00 00 00 00 00 00 00 24 03 00 C2 03    ...........$....
02E180:  1A 01 01 19 01 02 CE 38 04 CD 38 08 CC 38 01 CA    .......8..8..8..
02E190:  30 02 C9 30 04 C8 28 08 C7 28 02 C5 20 04 C4 18    0..0..(..(.. ...
02E1A0:  01 C2 18 02 C1 10 08 C0 08 02 BE 00 04 73 38 01    .............s8.
02E1B0:  71 38 04 70 30 01 6E 28 04 6D 20 01 6B 18 02 6A    q8.p0.n(.m .k..j
02E1C0:  10 08 69 08 02 67 00 08 66 00 01 1A 38 04 19 30    ..i..g..f...8..0
02E1D0:  08 18 28 02 16 28 04 15 20 01 13 18 02 12 18 04    ..(..(.. .......
02E1E0:  11 10 08 10 10 08 0F 10 01 0D 10 02 0C 08 02 0B    ................
02E1F0:  08 02 0A 08 02 09 08 02 08 08 02 07 10 01 06 10    ................
02E200:  00 59 4F 50 20 20 20 20 20 4D 55 53 00 00 00 00    .YOP     MUS....
02E210:  00 00 02 00 00 00 60 00 35 10 00 60 00 00 00 00    ......`.5..`....
02E220:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02E230:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02E240:  35 10 00 D9 03 27 02 03 33 02 01 29 82 35 82 29    5....'..3..).5.)
02E250:  02 03 35 02 01 29 82 35 82 29 02 03 35 02 01 2C    ..5..).5.)..5..,
02E260:  82 38 82 2C 02 03 38 02 01 2C 82 38 82 2C 02 03    .8.,..8..,.8.,..
02E270:  38 02 01 FF 00 40 FF 00 40 FF 1A 00 00 00 00 00    8....@..@.......
02E280:  C3 0B 60 C3 93 60 C3 77 60 66 04 06 03 DD 21 DA    ..`..`.w`f....!.
02E290:  63 FD 21 06 63 11 1C 00 C5 DD 36 06 01 DD 72 09    c.!.c.....6...r.
02E2A0:  DD 72 1B DD 36 05 10 FD 6E 00 FD 66 01 7E DD 77    .r..6...n..f.~.w
02E2B0:  08 23 4E 23 46 23 DD 75 0C DD 74 0D DD 71 00 DD    .#N#F#.u..t..q..
02E2C0:  70 01 DD 19 FD 23 FD 23 C1 10 CD 3E 06 32 BB 60    p....#.#...>.2.`
02E2D0:  7A 32 CF 60 3C 32 B6 60 3E 38 32 C0 60 3E FF 32    z2.`<2.`>82.`>.2
02E2E0:  02 63 32 03 63 32 04 63 32 05 63 3E 0C 4A CD E4    .c2.c2.c2.c>.J..
02E2F0:  62 3E 0D 4A C3 E4 62 3E 07 0E 3F CD E4 62 3E 08    b>.J..b>..?..b>.
02E300:  0E 00 CD E4 62 3E 09 0E 00 CD E4 62 3E 0A 0E 00    ....b>.....b>...
02E310:  C3 E4 62 21 B6 60 35 DD 21 DA 63 01 E8 63 CD 49    ..b!.`5.!.c..c.I
02E320:  61 DD 21 F6 63 01 04 64 CD 49 61 DD 21 12 64 01    a.!.c..d.Ia.!.d.
02E330:  20 64 CD 49 61 3E 00 B7 20 05 3E 00 32 B6 60 3E     d.Ia>.. .>.2.`>
02E340:  00 21 03 63 BE 28 07 77 4F 3E 07 CD E4 62 3E 00    .!.c.(.wO>...b>.
02E350:  21 02 63 BE 28 07 77 4F 3E 06 CD E4 62 3E 00 21    !.c.(.wO>...b>.!
02E360:  04 63 BE 28 07 77 4F 3E 0B CD E4 62 3E 00 21 05    .c.(.wO>...b>.!.
02E370:  63 BE C8 77 4F 3E 0D C3 E4 62 23 46 DD 70 06 23    c..wO>...b#F.p.#
02E380:  DD 75 00 DD 74 01 C3 FA 61 23 7E DD 77 06 23 DD    .u..t...a#~.w.#.
02E390:  75 00 DD 74 01 AF DD 77 17 DD 77 15 4F DD 7E 04    u..t...w..w.O.~.
02E3A0:  C3 E4 62 DD 36 0A 00 DD 6E 0C DD 66 0D 7E FE 80    ..b.6...n..f.~..
02E3B0:  20 06 23 5E 23 56 EB 7E 23 5E 23 56 23 DD 75 0C     .#^#V.~#^#V#.u.
02E3C0:  DD 74 0D DD 77 08 EB 18 13 3A B6 60 B7 C2 FA 61    .t..w....:.`...a
02E3D0:  DD 35 06 C2 FA 61 DD 6E 00 DD 66 01 7E B7 28 9A    .5...a.n..f.~.(.
02E3E0:  FE FE 28 A5 FE FF 28 BB 16 00 E6 7F D6 0A DD 86    ..(...(.........
02E3F0:  08 DD 77 07 87 5F E5 21 0C 63 19 7E DD 77 18 23    ..w.._.!.c.~.w.#
02E400:  00 53 54 41 52 46 49 45 4C 47 57 58 00 00 00 00    .STARFIELGWX....
02E410:  00 00 02 00 00 00 96 00 E0 00 00 96 00 00 00 00    ................
02E420:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02E430:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02E440:  E0 00 00 3E 06 E6 F0 C6 02 77 18 17 7E E6 F0 77    ...>.....w..~..w
02E450:  1C 7B FE 4A 20 05 AF 01 B6 FF 09 DD 77 01 23 3E    .{.J .......w.#>
02E460:  08 86 77 DD 23 DD 23 08 3D 20 BF C9 0C 05 79 2D    ..w.#.#.= ....y-
02E470:  2D 20 57 43 1F 36 8D 1C 18 33 48 02 32 12 65 1A    - WC.6...3H.2.e.
02E480:  C3 07 96 C3 23 96 C9 21 00 97 11 06 C2 3E 90 73    ....#..!.....>.s
02E490:  23 72 23 EB 01 00 08 09 30 04 01 4A C0 09 EB 3D    #r#.....0..J...=
02E4A0:  20 ED C9 3E 10 DD 21 A7 96 16 00 08 01 00 97 DD     ..>..!.........
02E4B0:  6E 00 62 29 09 4E 23 46 DD 6E 01 5D 62 09 7E E6    n.b).N#F.n.]b.~.
02E4C0:  F0 77 1C 7B FE 4A 20 05 AF 01 B6 FF 09 DD 77 01    .w.{.J .......w.
02E4D0:  23 3E 04 86 77 DD 23 DD 23 08 3D 20 CE 3E 0A DD    #>..w.#.#.= .>..
02E4E0:  21 C7 96 16 00 08 01 00 97 DD 6E 00 62 29 09 4E    !.........n.b).N
02E4F0:  23 46 DD 6E 01 5D 62 09 7E E6 0F FE 08 20 08 7E    #F.n.]b.~.... .~
02E500:  E6 F0 C6 02 77 18 17 7E E6 F0 77 1C 7B FE 4A 20    ....w..~..w.{.J 
02E510:  05 AF 01 B6 FF 09 DD 77 01 23 3E 08 86 77 DD 23    .......w.#>..w.#
02E520:  DD 23 08 3D 20 BF C9 0C 05 79 2D 2D 20 57 43 1F    .#.= ....y-- WC.
02E530:  36 8D 1C 18 33 48 02 32 12 65 1A 85 0B 42 2F 06    6...3H.2.e...B/.
02E540:  24 5D 3A 29 16 37 46 0C 2D 7B 07 2D 13 4E 15 02    $]:).7F.-{.-.N..
02E550:  46 26 34 5E 3F 88 25 35 1C 68 2F 00 00 00 00 00    F&4^?.%5.h/.....
02E560:  1A 0D 0A 0D 0A 4F 52 47 20 26 39 36 30 30 0D 0A    .....ORG &9600..
02E570:  57 52 49 54 45 20 22 53 54 41 52 46 49 45 4C 2E    WRITE "STARFIEL.
02E580:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02E590:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02E5A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02E5B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02E5C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02E5D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02E5E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02E5F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02E600:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
02E610:  27 00 01 00 02 09 4E E5 27 00 C1 02 00 00 00 02    '.....N.'.......
02E620:  27 00 C6 02 00 00 00 02 27 00 C2 02 00 00 00 02    '.......'.......
02E630:  27 00 C7 02 00 00 00 02 27 00 C3 02 00 00 00 02    '.......'.......
02E640:  27 00 C8 02 00 00 00 02 27 00 C4 02 00 00 00 02    '.......'.......
02E650:  27 00 C9 02 00 00 00 02 27 00 C5 02 00 00 00 02    '.......'.......
02E660:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02E670:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02E680:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02E690:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02E6A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02E6B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02E6C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02E6D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02E6E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02E6F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02E700:  7E DD 77 19 E1 3E 01 CB 7E 20 0D 23 7E CB 7F 28    ~.w..>..~ .#~..(
02E710:  07 E6 7F DD 77 06 18 53 DD 77 06 23 E5 7E F5 E6    ....w..S.w.#.~..
02E720:  0F DD BE 05 28 06 DD 77 05 DD 72 0A 87 87 87 5F    ....(..w..r...._
02E730:  21 42 64 19 50 59 ED A0 ED A0 ED A0 ED A0 ED A0    !Bd.PY..........
02E740:  ED A0 ED A0 ED A0 F1 E1 E6 F0 28 1F FE F0 CA A0    ..........(.....
02E750:  62 FE D0 CA BC 62 FE B0 CA C4 62 FE 80 D2 CC 62    b....b....b....b
02E760:  FE 10 20 07 AF DD 77 1B DD 77 09 23 DD 75 00 DD    .. ...w..w.#.u..
02E770:  74 01 DD 36 16 00 DD 36 17 20 DD 7E 17 B7 20 0E    t..6...6. .~.. .
02E780:  DD 7E 15 B7 C8 DD 77 17 DD 7E 14 DD 77 16 16 00    .~....w..~..w...
02E790:  DD 5E 16 DD 34 16 DD 35 17 DD 7E 1B B7 28 1A 67    .^..4..5..~..(.g
02E7A0:  DD 6E 1A 19 7E DD 46 07 80 87 42 4F 21 0C 63 09    .n..~.F...BO!.c.
02E7B0:  7E DD 77 18 23 7E DD 77 19 DD 66 0F DD 6E 0E 19    ~.w.#~.w..f..n..
02E7C0:  19 4E 23 46 DD 6E 18 DD 66 19 09 4D DD 7E 02 CD    .N#F.n..f..M.~..
02E7D0:  E4 62 4C DD 7E 03 CD E4 62 DD 66 11 DD 6E 10 19    .bL.~...b.f..n..
02E7E0:  7E CB 7F 20 12 E6 0F DD 96 0A 30 01 AF DD B6 09    ~.. ......0.....
02E7F0:  4F DD 7E 04 CD E4 62 DD 6E 12 DD 66 13 19 7E CB    O.~...b.n..f..~.
02E800:  7F C0 E6 1F DD 46 0B 4F B7 78 28 08 47 79 32 CF    .....F.O.x(.Gy2.
02E810:  60 78 D6 40 32 9B 62 3A C0 60 CB 47 32 C0 60 C9    `x.@2.b:.`.G2.`.
02E820:  23 7E E5 87 06 00 4F 21 C2 64 09 5E 23 56 DD 73    #~....O!.d.^#V.s
02E830:  1A DD 72 1B DD 36 09 00 E1 C3 EB 61 23 7E 32 BB    ..r..6.....a#~2.
02E840:  60 C3 EB 61 23 7E DD 77 0A C3 EB 61 DD 36 09 10    `..a#~.w...a.6..
02E850:  DD 36 1B 00 7E 0F 0F 0F 0F 32 ED 60 23 7E 32 DE    .6..~....2.`#~2.
02E860:  60 C3 EB 61 06 F4 ED 79 06 F6 ED 78 F6 C0 ED 79    `..a...y...x...y
02E870:  E6 3F ED 79 06 F4 ED 49 06 F6 4F F6 80 ED 79 ED    .?.y...I..O...y.
02E880:  49 C9 FF FF FF FF 02 67 38 67 6E 67 EE 0E 18 0E    I......g8gng....
02E890:  4D 0D 8E 0C DA 0B 2F 0B 8F 0A F7 09 68 09 E1 08    M...../.....h...
02E8A0:  61 08 E9 07 77 07 0C 07 A7 06 47 06 ED 05 98 05    a...w.....G.....
02E8B0:  47 05 FC 04 B4 04 70 04 31 04 F4 03 BC 03 86 03    G.....p.1.......
02E8C0:  53 03 24 03 F6 02 CC 02 A4 02 7E 02 5A 02 38 02    S.$.......~.Z.8.
02E8D0:  18 02 FA 01 DE 01 C3 01 AA 01 92 01 7B 01 66 01    ............{.f.
02E8E0:  52 01 3F 01 2D 01 1C 01 0C 01 FD 00 EF 00 E1 00    R.?.-...........
02E8F0:  D5 00 C9 00 BE 00 B3 00 A9 00 9F 00 96 00 8E 00    ................
02E900:  46 82 46 82 44 02 F2 02 44 02 01 44 82 C4 01 C4    F.F.D...D..D....
02E910:  01 C4 02 44 02 01 C4 01 44 82 44 82 41 02 F2 01    ...D....D.D.A...
02E920:  41 02 01 C1 01 41 82 C1 01 C1 02 41 02 01 C1 01    A....A.....A....
02E930:  41 82 41 82 42 02 F2 02 42 02 01 C2 01 42 82 C2    A.A.B...B....B..
02E940:  01 C2 02 42 02 01 C2 01 42 02 02 42 02 01 FF 46    ...B....B..B...F
02E950:  02 F2 01 46 02 01 46 82 C6 01 C6 01 C6 02 46 02    ...F..F.......F.
02E960:  01 C6 01 46 82 46 82 44 02 F2 02 44 02 01 44 82    ...F.F.D...D..D.
02E970:  C4 01 C4 01 C4 02 44 02 01 C4 01 44 82 44 82 41    ......D....D.D.A
02E980:  02 F2 01 41 02 01 C1 01 41 82 C1 01 C1 02 41 02    ...A....A.....A.
02E990:  01 C1 01 41 82 41 82 42 02 F2 02 42 02 01 C2 01    ...A.A.B...B....
02E9A0:  42 82 C2 01 C2 02 42 02 01 C2 01 42 82 42 82 FF    B.....B....B.B..
02E9B0:  46 02 F1 01 46 02 01 46 82 C6 01 46 82 46 82 C6    F...F..F...F.F..
02E9C0:  01 46 82 46 82 4B 02 F1 01 4B 02 01 4B 82 CB 01    .F.F.K...K..K...
02E9D0:  4B 82 4B 82 CB 01 4B 82 4B 82 49 02 F1 02 49 02    K.K...K.K.I...I.
02E9E0:  01 C9 01 49 82 49 82 49 82 C9 01 49 82 49 82 48    ...I.I.I...I.I.H
02E9F0:  02 F1 03 48 02 01 C8 01 48 82 48 82 48 82 C8 01    ...H....H.H.H...
02EA00:  48 82 48 82 FF 46 02 F1 01 46 02 01 46 82 C6 01    H.H..F...F..F...
02EA10:  46 82 46 82 C6 01 46 82 46 82 4B 02 F1 01 4B 02    F.F...F.F.K...K.
02EA20:  01 4B 82 CB 01 4B 82 4B 82 CB 01 4B 82 4B 82 49    .K...K.K...K.K.I
02EA30:  02 F1 02 49 02 01 C9 01 49 82 49 82 49 82 C9 01    ...I....I.I.I...
02EA40:  49 82 49 82 48 02 F1 03 48 02 01 C8 01 48 82 48    I.I.H...H....H.H
02EA50:  82 48 82 C8 01 48 82 48 82 FF 46 02 F2 01 46 02    .H...H.H..F...F.
02EA60:  01 46 82 C6 01 C6 01 C6 02 46 02 01 C6 01 46 82    .F.......F....F.
02EA70:  46 82 4B 02 F2 01 4B 02 01 4B 82 CB 01 CB 01 CB    F.K...K..K......
02EA80:  02 4B 02 01 CB 01 4B 82 4B 82 49 02 F2 02 49 02    .K....K.K.I...I.
02EA90:  01 C9 01 49 82 C9 01 C9 02 49 02 01 C9 01 49 82    ...I.....I....I.
02EAA0:  49 82 48 02 F2 03 48 02 01 C8 01 48 82 C8 01 C8    I.H...H....H....
02EAB0:  02 48 02 01 C8 01 48 82 48 82 FF 46 02 F2 01 46    .H....H.H..F...F
02EAC0:  02 01 46 82 C6 01 C6 01 C6 02 46 02 01 C6 01 46    ..F.......F....F
02EAD0:  82 46 82 4B 02 F2 01 4B 02 01 4B 82 CB 01 CB 01    .F.K...K..K.....
02EAE0:  CB 02 4B 02 01 CB 01 4B 82 4B 82 49 02 F2 02 49    ..K....K.K.I...I
02EAF0:  02 01 C9 01 49 82 C9 01 C9 02 49 02 01 C9 01 49    ....I.....I....I
02EB00:  86 00 7F 00 77 00 71 00 6A 00 64 00 5F 00 59 00    ....w.q.j.d._.Y.
02EB10:  54 00 50 00 4B 00 47 00 43 00 3F 00 3C 00 38 00    T.P.K.G.C.?.<.8.
02EB20:  35 00 32 00 2F 00 2D 00 2A 00 28 00 26 00 24 00    5.2./.-.*.(.&.$.
02EB30:  22 00 20 00 1E 00 1C 00 1B 00 19 00 18 00 16 00    ". .............
02EB40:  15 00 14 00 13 00 12 00 11 00 10 00 0F 00 00 00    ................
02EB50:  00 00 00 00 00 00 00 00 00 00 00 00 00 01 08 00    ................
02EB60:  00 00 00 00 00 DF 00 00 00 00 00 00 00 00 00 00    ................
02EB70:  00 00 00 00 00 00 00 00 02 03 09 00 00 00 00 00    ................
02EB80:  00 E7 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02EB90:  00 00 00 00 04 05 0A 00 00 00 00 00 00 EF 00 00    ................
02EBA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02EBB0:  00 00 00 00 00 00 00 00 53 54 2D 4D 6F 64 75 6C    ........ST-Modul
02EBC0:  65 2E E2 64 22 65 42 65 10 10 62 65 A2 65 42 65    e..d"eBe..be.eBe
02EBD0:  08 00 C2 65 02 66 22 66 00 00 62 65 42 66 62 66    ...e.f"f..beBfbf
02EBE0:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
02EBF0:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
02EC00:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
02EC10:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
02EC20:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
02EC30:  00 00 DC 5E DC 5E DC 5E 00 00 DC 5E DC 5E DC 5E    ...^.^.^...^.^.^
02EC40:  00 00 82 66 A2 66 C2 66 E2 66 DC 5E DC 5E DC 5E    ...f.f.f.f.^.^.^
02EC50:  DC 5E DC 5E DC 5E DC 5E DC 5E DC 5E DC 5E DC 5E    .^.^.^.^.^.^.^.^
02EC60:  DC 5E 01 00 01 00 01 00 01 00 00 00 00 00 00 00    .^..............
02EC70:  00 00 01 00 01 00 01 00 01 00 00 00 00 00 00 00    ................
02EC80:  00 00 01 00 01 00 01 00 01 00 00 00 00 00 00 00    ................
02EC90:  00 00 01 00 01 00 01 00 01 00 00 00 00 00 00 00    ................
02ECA0:  00 00 0F 0E 0D 0C 80 80 80 80 80 80 80 80 80 80    ................
02ECB0:  80 80 80 80 80 80 80 80 80 80 80 80 80 80 80 80    ................
02ECC0:  80 80 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02ECD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02ECE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02ECF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02ED00:  82 49 82 48 02 F2 03 48 02 01 C8 01 48 82 C8 01    .I.H...H....H...
02ED10:  C8 02 48 02 01 C8 01 48 82 48 82 FF 46 02 F1 01    ..H....H.H..F...
02ED20:  46 02 01 46 82 C6 01 46 82 46 82 C6 01 46 82 46    F..F...F.F...F.F
02ED30:  82 44 02 F1 02 44 02 01 44 82 C4 01 44 82 44 82    .D...D..D...D.D.
02ED40:  C4 01 44 82 44 82 41 02 F1 01 41 02 01 C1 01 41    ..D.D.A...A....A
02ED50:  82 41 82 41 82 C1 01 41 82 41 82 42 02 F1 02 42    .A.A...A.A.B...B
02ED60:  02 01 C2 01 42 82 42 82 42 82 C2 01 42 82 42 82    ....B.B.B...B.B.
02ED70:  FF 22 02 01 2E 82 22 82 2E 82 22 82 2E 82 22 82    ."...."..."...".
02ED80:  2E 82 2C 82 38 82 2C 82 38 82 2C 82 38 82 2C 82    ..,.8.,.8.,.8.,.
02ED90:  38 82 29 82 35 82 29 82 35 82 29 82 35 82 29 82    8.).5.).5.).5.).
02EDA0:  35 82 2A 82 36 82 2A 82 36 82 2A 82 36 82 2A 82    5.*.6.*.6.*.6.*.
02EDB0:  36 82 FF 22 02 01 2E 82 22 02 03 2E 02 01 22 82    6.."....".....".
02EDC0:  2E 82 22 02 03 2E 02 01 2C 82 38 82 2C 02 03 38    ..".....,.8.,..8
02EDD0:  02 01 2C 82 38 82 2C 02 03 38 02 01 29 82 35 82    ..,.8.,..8..).5.
02EDE0:  29 02 03 35 02 01 29 82 35 82 29 02 03 35 02 01    )..5..).5.)..5..
02EDF0:  2A 82 36 82 2A 02 03 36 02 01 2A 82 36 82 2A 02    *.6.*..6..*.6.*.
02EE00:  03 36 02 01 FF C4 00 46 82 C4 00 46 82 C4 00 46    .6.....F...F...F
02EE10:  82 C4 00 46 82 C4 00 46 82 C4 00 46 82 C4 00 46    ...F...F...F...F
02EE20:  82 C4 00 46 82 C4 00 46 82 C4 00 46 82 C4 00 C6    ...F...F...F....
02EE30:  00 C1 00 44 82 C1 00 44 82 C1 00 44 82 C1 00 44    ...D...D...D...D
02EE40:  82 C1 00 44 82 C1 00 44 82 C1 00 44 82 C1 00 44    ...D...D...D...D
02EE50:  82 C1 00 44 82 C1 00 44 82 C1 00 C4 00 FF C4 00    ...D...D........
02EE60:  46 82 C4 00 46 82 C4 00 46 82 C4 00 46 82 C4 00    F...F...F...F...
02EE70:  46 82 C4 00 46 82 C4 00 46 82 C4 00 46 82 C4 00    F...F...F...F...
02EE80:  46 82 C4 00 46 82 C4 00 C6 00 C1 00 44 82 C1 00    F...F.......D...
02EE90:  44 82 C1 00 44 82 C1 00 44 82 C1 00 44 82 C1 00    D...D...D...D...
02EEA0:  44 82 C1 00 44 82 C1 00 44 82 C1 00 44 82 C1 00    D...D...D...D...
02EEB0:  44 82 C1 00 C4 00 FF 22 02 01 2E 82 22 02 03 2E    D......"...."...
02EEC0:  02 01 22 82 2E 82 22 02 03 2E 02 01 27 82 33 82    .."...".....'.3.
02EED0:  27 02 03 33 02 01 27 82 33 82 27 02 03 33 02 01    '..3..'.3.'..3..
02EEE0:  29 82 35 82 29 02 03 35 02 01 29 82 35 82 29 02    ).5.)..5..).5.).
02EEF0:  03 35 02 01 2C 82 38 82 2C 02 03 38 02 01 2C 82    .5..,.8.,..8..,.
02EF00:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02EF10:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02EF20:  00 00 0F 0E 0D 0C 0B 0A 0A 0A 0A 0A 0A 0A 0A 0A    ................
02EF30:  0A 0A 0A 0A 0A 0A 0A 0A 09 08 07 06 05 04 03 02    ................
02EF40:  01 00 80 00 00 01 80 01 00 02 80 02 00 03 00 04    ................
02EF50:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02EF60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02EF70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02EF80:  00 00 0F 0F 0E 0E 0D 0C 00 00 00 00 00 00 00 00    ................
02EF90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02EFA0:  00 00 06 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02EFB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02EFC0:  00 00 0F 0D 0B 09 07 05 04 06 08 06 04 02 00 00    ................
02EFD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02EFE0:  00 00 07 0B 0F 13 17 1B 1F 13 08 03 00 00 00 00    ................
02EFF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02F000:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02F010:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02F020:  00 00 00 03 07 0C 00 03 07 0C 00 03 07 0C 00 03    ................
02F030:  07 0C 00 03 07 0C 00 03 07 0C 00 03 07 0C 00 03    ................
02F040:  07 0C 00 04 07 0C 00 04 07 0C 00 04 07 0C 00 04    ................
02F050:  07 0C 00 04 07 0C 00 04 07 0C 00 04 07 0C 00 04    ................
02F060:  07 0C 00 03 08 0C 00 03 08 0C 00 03 08 0C 00 03    ................
02F070:  08 0C 00 03 08 0C 00 03 08 0C 00 03 08 0C 00 03    ................
02F080:  08 0C 00 A4 67 00 BC 67 00 D6 67 00 D6 67 00 A4    ....g..g..g..g..
02F090:  67 00 F8 67 00 D6 67 00 10 68 00 30 68 00 52 68    g..g..g..h.0h.Rh
02F0A0:  00 52 68 00 A2 68 00 DB 68 00 17 69 00 17 69 00    .Rh..h..h..i..i.
02F0B0:  40 69 00 01 6A 80 02 67 00 C2 6A 00 17 6B 00 6C    @i..j..g..j..k.l
02F0C0:  6B 00 6C 6B 00 17 6B 00 17 6B 00 6C 6B 00 CF 6B    k.lk..k..k.lk..k
02F0D0:  00 30 6C 00 85 6C 00 DA 6C 00 3B 6D 00 DA 6C 00    .0l..l..l.;m..l.
02F0E0:  DA 6C 00 DA 6C 00 DA 6C 00 9C 6D 80 38 67 00 F1    .l..l..l..m.8g..
02F0F0:  6D 00 F1 6D 00 33 6E 00 33 6E 00 85 6E 00 DE 6E    m..m.3n.3n..n..n
02F100:  38 82 2C 02 03 38 02 01 FF 22 02 01 2E 82 22 02    8.,..8..."....".
02F110:  03 2E 02 01 22 82 2E 82 22 02 03 2E 02 01 27 82    ...."...".....'.
02F120:  33 82 27 02 03 33 02 01 27 82 33 82 27 02 03 33    3.'..3..'.3.'..3
02F130:  02 01 29 82 35 82 29 02 03 35 02 01 29 82 35 82    ..).5.)..5..).5.
02F140:  29 02 03 35 02 01 2C 82 38 82 2C 02 03 38 02 01    )..5..,.8.,..8..
02F150:  2C 82 38 82 2C 02 03 38 02 01 FF 22 02 F1 00 2E    ,.8.,..8..."....
02F160:  02 01 22 02 03 2E 02 01 22 82 2E 82 22 02 03 2E    .."....."..."...
02F170:  02 01 27 82 33 82 27 02 03 33 02 01 27 82 33 82    ..'.3.'..3..'.3.
02F180:  27 02 03 33 02 01 29 82 35 82 29 02 03 35 02 01    '..3..).5.)..5..
02F190:  29 82 35 82 29 02 03 35 02 01 2C 82 38 82 2C 02    ).5.)..5..,.8.,.
02F1A0:  03 38 02 01 2C 82 38 82 2C 02 03 38 02 01 FF 00    .8..,.8.,..8....
02F1B0:  40 FF 00 40 FF 1A 00 00 00 00 00 00 00 00 00 00    @..@............
02F1C0:  00 2B 00 3F 04 00 00 59 4F 50 20 20 20 20 20 24    .+.?...YOP     $
02F1D0:  24 24 FF 00 FF 00 00 02 00 00 80 40 00 00 2B 00    $$.........@..+.
02F1E0:  00 00 00 00 00 00 00 53 54 00 00 00 00 00 00 00    .......ST.......
02F1F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02F200:  03 36 02 01 FF C4 00 46 82 C4 00 46 82 C4 00 46    .6.....F...F...F
02F210:  82 C4 00 46 82 C4 00 46 82 C4 00 46 82 C4 00 46    ...F...F...F...F
02F220:  82 C4 00 46 82 C4 00 46 82 C4 00 46 82 C4 00 C6    ...F...F...F....
02F230:  00 C1 00 44 82 C1 00 44 82 C1 00 44 82 C1 00 44    ...D...D...D...D
02F240:  82 C1 00 44 82 C1 00 44 82 C1 00 44 82 C1 00 44    ...D...D...D...D
02F250:  82 C1 00 44 82 C1 00 44 82 C1 00 C4 00 FF C4 00    ...D...D........
02F260:  46 82 C4 00 46 82 C4 00 46 82 C4 00 46 82 C4 00    F...F...F...F...
02F270:  46 82 C4 00 46 82 C4 00 46 82 C4 00 46 82 C4 00    F...F...F...F...
02F280:  46 82 C4 00 46 82 C4 00 C6 00 C1 00 44 82 C1 00    F...F.......D...
02F290:  44 82 C1 00 44 82 C1 00 44 82 C1 00 44 82 C1 00    D...D...D...D...
02F2A0:  44 82 C1 00 44 82 C1 00 44 82 C1 00 44 82 C1 00    D...D...D...D...
02F2B0:  44 82 C1 00 C4 00 FF 22 02 01 2E 82 22 02 03 2E    D......"...."...
02F2C0:  02 01 22 82 2E 82 22 02 03 2E 02 01 27 82 33 82    .."...".....'.3.
02F2D0:  27 02 03 33 02 01 27 82 33 82 27 02 03 33 02 01    '..3..'.3.'..3..
02F2E0:  29 82 35 82 29 02 03 35 02 01 29 82 35 82 29 02    ).5.)..5..).5.).
02F2F0:  03 35 02 01 2C 82 38 82 2C 02 03 38 02 01 2C 82    .5..,.8.,..8..,.
02F300:  00 33 6E 00 33 6E 00 85 6E 00 85 6E 00 37 6F 00    .3n.3n..n..n.7o.
02F310:  89 6F 00 89 6F 00 DB 6F 00 DB 6F 00 2F 70 00 32    .o..o..o..o./p.2
02F320:  70 80 6E 67 46 04 00 48 82 49 86 4B 82 49 88 48    p.ngF..H.I.K.I.H
02F330:  8A 44 84 46 82 48 86 49 82 46 92 FF 46 04 00 48    .D.F.H.I.F..F..H
02F340:  82 49 86 4B 82 49 88 48 8A 44 84 46 82 48 86 49    .I.K.I.H.D.F.H.I
02F350:  82 4D 8E 50 84 FF 52 0C 00 D0 00 4D 83 50 82 4D    .M.P..R....M.P.M
02F360:  82 4B 82 4D 86 CD 00 50 83 52 8C D0 00 4D 83 50    .K.M...P.R...M.P
02F370:  82 4D 82 4B 82 4D 8A FF 46 04 00 48 82 49 86 4B    .M.K.M..F..H.I.K
02F380:  82 49 88 48 8A 44 84 46 82 48 86 49 82 4D 92 FF    .I.H.D.F.H.I.M..
02F390:  4D 04 00 4E 82 50 86 52 82 50 86 4E 82 4D 86 4E    M..N.P.R.P.N.M.N
02F3A0:  82 4D 88 4B 82 4E 82 4D 82 CB 00 4D 83 49 90 FF    .M.K.N.M...M.I..
02F3B0:  4D 04 00 50 82 52 86 54 82 55 8C 57 82 59 82 59    M..P.R.T.U.W.Y.Y
02F3C0:  86 57 82 55 84 57 84 54 86 55 82 54 84 50 84 4D    .W.U.W.T.U.T.P.M
02F3D0:  82 FF 4D 02 00 C6 00 4B 82 C6 00 49 82 C6 00 48    ..M....K...I...H
02F3E0:  82 C6 00 49 82 4B 82 4D 82 C6 00 4B 82 C6 00 49    ...I.K.M...K...I
02F3F0:  82 C6 00 48 82 C6 00 49 82 4B 82 4D 82 C4 00 4B    ...H...I.K.M...K
02F400:  82 C4 00 49 82 C4 00 48 82 C4 00 49 82 4B 82 4B    ...I...H...I.K.K
02F410:  82 C4 00 49 82 C4 00 48 82 C4 00 46 82 C4 00 48    ...I...H...F...H
02F420:  84 FF 46 02 00 49 82 4D 82 4B 86 49 84 46 82 52    ..F..I.M.K.I.F.R
02F430:  02 01 52 82 D2 01 52 82 52 82 D2 01 52 84 4D 02    ..R...R.R...R.M.
02F440:  00 50 82 55 82 54 86 50 84 50 82 50 02 01 50 82    .P.U.T.P.P.P..P.
02F450:  D0 01 50 82 50 82 D0 01 50 84 FF C9 00 C8 00 C6    ..P.P...P.......
02F460:  00 C4 00 46 86 49 82 4D 82 4B 86 49 82 46 82 D2    ...F.I.M.K.I.F..
02F470:  01 52 82 52 82 D2 01 52 82 C9 00 C8 00 C6 00 C4    .R.R...R........
02F480:  00 41 86 44 82 49 82 48 86 44 82 44 82 50 02 01    .A.D.I.H.D.D.P..
02F490:  D0 01 50 83 50 82 FF 46 04 B0 00 48 02 00 49 86    ..P.P..F...H..I.
02F4A0:  4B 82 4D 86 49 82 50 84 4D 85 CA F0 00 4B 82 4D    K.M.I.P.M....K.M
02F4B0:  04 00 4D 89 C8 00 49 02 F0 00 4B 04 00 4B 8A FF    ..M...I...K..K..
02F4C0:  D2 B0 00 D2 B0 01 D2 B0 01 D2 B0 02 D2 B0 02 D2    ................
02F4D0:  B0 03 D2 B0 03 D2 B0 03 D2 B0 03 D2 B0 04 D2 B0    ................
02F4E0:  04 D2 B0 04 D2 B0 05 D2 B0 05 D2 B0 05 D2 B0 05    ................
02F4F0:  CD B0 00 CD B0 00 CD B0 01 CD B0 01 CD B0 02 CD    ................
02F500:  6F 6E 74 20 20 5B 4C 5D 6F 67 6F 20 20 5B 4D 5D    ont  [L]ogo  [M]
02F510:  75 73 69 63 20 20 5B 31 5D 73 74 20 73 66 78 20    usic  [1]st sfx 
02F520:  20 20 5B 32 5D 6E 64 20 73 66 78 00 04 01 43 6F      [2]nd sfx...Co
02F530:  6D 6D 61 6E 64 20 20 20 3A 20 28 44 29 69 72 20    mmand   : (D)ir 
02F540:  20 20 28 41 29 3A 20 20 20 20 28 42 29 3A 20 20      (A):    (B):  
02F550:  20 20 28 4F 29 70 65 6E 20 20 20 28 53 29 61 76      (O)pen   (S)av
02F560:  65 20 61 6C 6C 20 20 28 43 29 6F 6E 66 69 67 20    e all  (C)onfig 
02F570:  20 28 56 29 69 65 77 00 05 01 9A 9A 9A 9A 9A 9A     (V)iew.........
02F580:  9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A    ................
02F590:  9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A    ................
02F5A0:  9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A    ................
02F5B0:  9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 9A    ................
02F5C0:  9A 9A 9A 9A 9A 9A 9A 9A 9A 9A 00 01 3A 46 69 6C    ............:Fil
02F5D0:  65 20 20 20 3A 20 20 3A 20 20 20 20 20 20 20 20    e   :  :        
02F5E0:  2E 47 57 43 00 CD 18 BB FE 31 CA F9 0E FE 32 CA    .GWC.....1....2.
02F5F0:  00 0F E6 DF FE 49 CA FC 0A FE 44 CA 4B 09 FE 4F    .....I....D.K..O
02F600:  CA 81 0B FE 53 CA 2A 0D FE 41 CA 90 0E FE 42 CA    ....S.*..A....B.
02F610:  9A 0E FE 54 CA B4 0E FE 4C CA EB 0E FE 46 CA F2    ...T....L....F..
02F620:  0E FE 4D CA E4 0E FE 43 C2 F1 0A CD 40 00 C3 A5    ..M....C....@...
02F630:  0A FE 56 C2 A5 0A CD 43 00 C3 A4 08 CD F3 08 21    ..V....C.......!
02F640:  14 0B CD E1 08 21 32 0B CD E1 08 21 51 0B CD E1    .....!2....!Q...
02F650:  08 C3 A5 0A 0B 1B 47 68 6F 75 6C 27 73 20 57 72    ......Ghoul's Wr
02F660:  69 74 65 72 20 4C 69 6E 6B 65 72 20 20 76 31 2E    iter Linker  v1.
02F670:  30 00 0D 1A 43 6F 64 65 64 20 62 79 20 54 6F 6D    0...Coded by Tom
02F680:  20 65 74 20 4A 65 72 72 79 20 6F 66 20 47 50 41     et Jerry of GPA
02F690:  00 0F 1A 54 68 69 73 20 70 72 6F 67 72 61 6D 20    ...This program 
02F6A0:  69 73 20 73 68 61 72 65 77 61 72 65 20 21 21 00    is shareware !!.
02F6B0:  0E FF 0C D6 0A 30 FB C6 3A 23 77 2B 79 C6 30 77    .....0..:#w+y.0w
02F6C0:  C9 CD F3 08 CD 16 09 21 23 0C CD E1 08 21 0B 08    .......!#....!..
02F6D0:  11 1A 08 01 0C 00 ED B0 21 18 08 CD 93 0C FE FC    ........!.......
02F6E0:  20 06 CD F3 08 C3 A5 0A CD F3 08 3A 5A BB 32 27     ..........:Z.2'
02F6F0:  08 3E C9 32 5A BB 21 1A 08 06 0C 11 00 C0 CD 77    .>.2Z.!........w
02F700:  B0 02 CD B0 03 CD B0 03 CD B0 04 CD B0 04 CD B0    ................
02F710:  05 CD B0 05 CD B0 06 CD B0 06 CD B0 07 CD B0 07    ................
02F720:  CB B0 00 CB B0 00 CB B0 01 CB B0 01 CB B0 02 CB    ................
02F730:  B0 02 CB B0 03 CB B0 03 CB B0 04 CB B0 04 CB B0    ................
02F740:  05 CB B0 05 CB B0 06 CB B0 06 CB B0 07 CB B0 07    ................
02F750:  D0 B0 00 D0 B0 00 D0 B0 01 D0 B0 01 D0 B0 02 D0    ................
02F760:  B0 02 D0 B0 03 D0 B0 03 D0 B0 04 D0 B0 04 D0 B0    ................
02F770:  05 D0 B0 05 D0 B0 06 D0 B0 06 D0 B0 07 D0 B0 07    ................
02F780:  FF CD B0 00 CD B0 01 CD B0 01 CD B0 02 CD B0 02    ................
02F790:  CD B0 03 CD B0 03 CD B0 04 CD B0 04 CD B0 05 CD    ................
02F7A0:  B0 05 CD B0 06 CD B0 06 CD B0 07 CD B0 07 CD B0    ................
02F7B0:  08 CB B0 00 CB B0 01 CB B0 01 CB B0 02 CB B0 02    ................
02F7C0:  CB B0 03 CB B0 03 CB B0 04 CB B0 04 CB B0 05 CB    ................
02F7D0:  B0 05 CB B0 06 CB B0 06 CB B0 07 CB B0 07 CB B0    ................
02F7E0:  08 CD B0 00 CD B0 01 CD B0 01 CD B0 02 CD B0 02    ................
02F7F0:  CD B0 03 CD B0 03 CD B0 04 CD B0 04 CD B0 05 CD    ................
02F800:  B0 05 CD B0 06 CD B0 06 CD B0 07 CD B0 07 CD B0    ................
02F810:  08 C9 B0 00 C9 B0 01 C9 B0 01 C9 B0 02 C9 B0 02    ................
02F820:  C9 B0 03 C9 B0 03 C9 B0 04 C9 B0 04 C9 B0 05 C9    ................
02F830:  B0 05 C9 B0 06 CB B0 00 CB B0 01 CB B0 01 CB B0    ................
02F840:  02 FF 46 02 F1 01 46 02 01 46 82 C6 01 46 82 46    ..F...F..F...F.F
02F850:  82 C6 01 46 82 46 82 44 02 F1 02 44 02 01 44 82    ...F.F.D...D..D.
02F860:  C4 01 44 82 44 82 C4 01 44 82 44 82 41 02 F1 01    ..D.D...D.D.A...
02F870:  41 02 01 C1 01 41 82 41 82 41 82 C1 01 41 82 41    A....A.A.A...A.A
02F880:  82 42 02 F1 02 42 02 01 C2 01 42 82 42 82 42 82    .B...B....B.B.B.
02F890:  C2 01 42 82 42 82 FF 46 02 F1 01 46 02 01 46 82    ..B.B..F...F..F.
02F8A0:  C6 01 46 82 46 82 C6 01 46 82 46 82 44 02 F1 02    ..F.F...F.F.D...
02F8B0:  44 02 01 44 82 C4 01 44 82 44 82 C4 01 44 82 44    D..D...D.D...D.D
02F8C0:  82 41 02 F1 01 41 02 01 C1 01 41 82 41 82 41 82    .A...A....A.A.A.
02F8D0:  C1 01 41 82 41 82 42 02 F1 02 42 02 01 C2 01 42    ..A.A.B...B....B
02F8E0:  82 42 82 42 82 C2 01 42 82 42 82 FF 46 02 F2 01    .B.B...B.B..F...
02F8F0:  46 02 01 46 82 C6 01 C6 01 C6 02 46 02 01 C6 01    F..F.......F....
02F900:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
02F910:  28 00 01 00 02 09 4E E5 28 00 C1 02 00 00 00 02    (.....N.(.......
02F920:  28 00 C6 02 00 00 00 02 28 00 C2 02 00 00 00 02    (.......(.......
02F930:  28 00 C7 02 00 00 00 02 28 00 C3 02 00 00 00 02    (.......(.......
02F940:  28 00 C8 02 00 00 00 02 28 00 C4 02 00 00 00 02    (.......(.......
02F950:  28 00 C9 02 00 00 00 02 28 00 C5 02 00 00 00 02    (.......(.......
02F960:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02F970:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02F980:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02F990:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02F9A0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02F9B0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02F9C0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02F9D0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02F9E0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02F9F0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
02FA00:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FA10:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FA20:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FA30:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FA40:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FA50:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FA60:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FA70:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FA80:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FA90:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FAA0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FAB0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FAC0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FAD0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FAE0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FAF0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FB00:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FB10:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FB20:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FB30:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FB40:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FB50:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FB60:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FB70:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FB80:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FB90:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FBA0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FBB0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FBC0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FBD0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FBE0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FBF0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FC00:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FC10:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FC20:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FC30:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FC40:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FC50:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FC60:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FC70:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FC80:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FC90:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FCA0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FCB0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FCC0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FCD0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FCE0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FCF0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FD00:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FD10:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FD20:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FD30:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FD40:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FD50:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FD60:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FD70:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FD80:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FD90:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FDA0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FDB0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FDC0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FDD0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FDE0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FDF0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FE00:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FE10:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FE20:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FE30:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FE40:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FE50:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FE60:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FE70:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FE80:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FE90:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FEA0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FEB0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FEC0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FED0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FEE0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FEF0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FF00:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FF10:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FF20:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FF30:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FF40:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FF50:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FF60:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FF70:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FF80:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FF90:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FFA0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FFB0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FFC0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FFD0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FFE0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
02FFF0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030000:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030010:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030020:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030030:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030040:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030050:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030060:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030070:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030080:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030090:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0300A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0300B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0300C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0300D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0300E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0300F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030100:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030110:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030120:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030130:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030140:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030150:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030160:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030170:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030180:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030190:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0301A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0301B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0301C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0301D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0301E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0301F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030200:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030210:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030220:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030230:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030240:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030250:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030260:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030270:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030280:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030290:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0302A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0302B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0302C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0302D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0302E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0302F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030300:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030310:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030320:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030330:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030340:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030350:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030360:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030370:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030380:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030390:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0303A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0303B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0303C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0303D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0303E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0303F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030400:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030410:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030420:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030430:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030440:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030450:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030460:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030470:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030480:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030490:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0304A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0304B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0304C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0304D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0304E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0304F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030500:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030510:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030520:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030530:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030540:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030550:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030560:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030570:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030580:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030590:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0305A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0305B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0305C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0305D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0305E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0305F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030600:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030610:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030620:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030630:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030640:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030650:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030660:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030670:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030680:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030690:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0306A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0306B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0306C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0306D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0306E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0306F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030700:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030710:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030720:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030730:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030740:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030750:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030760:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030770:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030780:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030790:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0307A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0307B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0307C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0307D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0307E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0307F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030800:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030810:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030820:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030830:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030840:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030850:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030860:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030870:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030880:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030890:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0308A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0308B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0308C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0308D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0308E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0308F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030900:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030910:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030920:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030930:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030940:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030950:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030960:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030970:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030980:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030990:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0309A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0309B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0309C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0309D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0309E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0309F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030A00:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030A10:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030A20:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030A30:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030A40:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030A50:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030A60:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030A70:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030A80:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030A90:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030AA0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030AB0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030AC0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030AD0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030AE0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030AF0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030B00:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030B10:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030B20:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030B30:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030B40:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030B50:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030B60:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030B70:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030B80:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030B90:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030BA0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030BB0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030BC0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030BD0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030BE0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030BF0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030C00:  54 72 61 63 6B 2D 49 6E 66 6F 0D 0A 00 00 00 00    Track-Info......
030C10:  29 00 01 00 02 09 4E E5 29 00 C1 02 00 00 00 02    ).....N.).......
030C20:  29 00 C6 02 00 00 00 02 29 00 C2 02 00 00 00 02    ).......).......
030C30:  29 00 C7 02 00 00 00 02 29 00 C3 02 00 00 00 02    ).......).......
030C40:  29 00 C8 02 00 00 00 02 29 00 C4 02 00 00 00 02    ).......).......
030C50:  29 00 C9 02 00 00 00 02 29 00 C5 02 00 00 00 02    ).......).......
030C60:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
030C70:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
030C80:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
030C90:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
030CA0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
030CB0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
030CC0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
030CD0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
030CE0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
030CF0:  00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00    ................
030D00:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030D10:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030D20:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030D30:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030D40:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030D50:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030D60:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030D70:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030D80:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030D90:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030DA0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030DB0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030DC0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030DD0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030DE0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030DF0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030E00:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030E10:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030E20:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030E30:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030E40:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030E50:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030E60:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030E70:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030E80:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030E90:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030EA0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030EB0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030EC0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030ED0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030EE0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030EF0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030F00:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030F10:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030F20:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030F30:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030F40:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030F50:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030F60:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030F70:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030F80:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030F90:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030FA0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030FB0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030FC0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030FD0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030FE0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
030FF0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031000:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031010:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031020:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031030:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031040:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031050:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031060:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031070:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031080:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031090:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0310A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0310B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0310C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0310D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0310E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0310F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031100:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031110:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031120:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031130:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031140:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031150:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031160:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031170:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031180:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031190:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0311A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0311B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0311C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0311D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0311E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0311F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031200:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031210:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031220:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031230:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031240:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031250:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031260:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031270:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031280:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031290:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0312A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0312B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0312C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0312D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0312E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0312F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031300:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031310:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031320:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031330:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031340:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031350:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031360:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031370:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031380:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031390:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0313A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0313B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0313C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0313D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0313E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0313F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031400:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031410:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031420:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031430:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031440:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031450:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031460:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031470:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031480:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031490:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0314A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0314B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0314C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0314D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0314E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0314F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031500:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031510:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031520:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031530:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031540:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031550:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031560:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031570:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031580:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031590:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0315A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0315B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0315C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0315D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0315E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0315F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031600:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031610:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031620:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031630:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031640:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031650:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031660:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031670:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031680:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031690:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0316A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0316B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0316C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0316D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0316E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0316F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031700:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031710:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031720:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031730:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031740:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031750:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031760:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031770:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031780:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031790:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0317A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0317B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0317C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0317D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0317E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0317F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031800:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031810:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031820:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031830:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031840:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031850:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031860:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031870:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031880:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031890:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0318A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0318B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0318C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0318D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0318E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0318F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031900:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031910:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031920:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031930:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031940:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031950:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031960:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031970:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031980:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031990:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0319A0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0319B0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0319C0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0319D0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0319E0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
0319F0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031A00:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031A10:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031A20:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031A30:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031A40:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031A50:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031A60:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031A70:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031A80:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031A90:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031AA0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031AB0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031AC0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031AD0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031AE0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031AF0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031B00:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031B10:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031B20:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031B30:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031B40:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031B50:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031B60:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031B70:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031B80:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031B90:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031BA0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031BB0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031BC0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031BD0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031BE0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031BF0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031C00:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031C10:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031C20:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031C30:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031C40:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031C50:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031C60:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031C70:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031C80:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031C90:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031CA0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031CB0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031CC0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031CD0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031CE0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031CF0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031D00:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031D10:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031D20:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031D30:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031D40:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031D50:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031D60:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031D70:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031D80:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031D90:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031DA0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031DB0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031DC0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031DD0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031DE0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031DF0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031E00:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031E10:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031E20:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031E30:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031E40:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031E50:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031E60:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031E70:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031E80:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031E90:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031EA0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031EB0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031EC0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031ED0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031EE0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
031EF0:  E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5 E5    ................
RESULT OF SEARCH :
PRO=81   CHEA=0   COD=21   MUSI=44   COP=6   GRA=74   WRIT=68   198=1   199=22   STARTER=0   KBI=0   CAAV=0   L.TOURNIER=0  
EXTENDED CPC DSK File    SAMdisk180707*  O-GW-FR  BAS-GWEDIT BAS-GWLOGO BAS BUBB
LE  GWXCPC     GWEFIVE    FNTGW-UK   DOC  INTRO   DAT LINE    GWEMOUTH   GWEPC  
    GWERANDOM  GWESNOW    GWXSUBMARINGWX !UP-DOWN2GWE"-GW-ST  BAS&#$%&'cana     
       ,(,,   ix   , "R ..............  Restart program" , "Q ..............  Qu
it"F"" "r"  "q"(C) "q"    ware !     , u "Print user's manual (Y / N)""" "Y"  "N
"(C) cana "Y"   cana  $F  cana   "Printing...."P  "GW-FR.DOC"Z    £ #,!d      # 
cana, Kn  -GWFONT BAS()ACCENTS DAT*CHAMPAG2GWX+CURTAIN GWE,G-W     GWL-./0GWDEMO
  BINF123456789LARGER  FNTLINEOUT FNTNO-FX2  GWXPC-CGA  GWESCRIPT2 FNTSQUARE  FN
TSYS-FR  FNTWALES   MUSABCD-GW-UK  BASE-GWFRAMEBASF-GWEDIT BASpit.bin", "sys-uk.
fnt",( "more-chr.dat",# Ghoul's writer editor v 1.0$ Tom et Jerry of GPA (c) 199
4   N %"d"  "gwedit.bin", "sys-uk.fnt",( "more-chr.dat", 2 EDIT  $$$ror...  File
 has no name...&9500  WRITE "ACCENTS DATARMY    FNTGCHAMPAGNGWXHDEPECHE MUS$IJKL
MGW-CLIP SCRNOPQRSTUVWXYZGW-CLIP SCRGWEDIT  BIN1abcdeLEGEND  MUS!fghijMIRAGE  GW
EkNO-LOGO GWLlmnoPIG     GWLpqrsSILVERMAMUS+tuvwxySQUARE-1FNTzSYS-UK  FNTYESOD  
 MUS-GWDEMO BAS-GWLINK BASe already loaded in memory (Y/N)"0x"" "Y"  "N"(C) "Y" 
    - Load .SCR file (font starts at &C000) 4£ "Name of the 17ko font file  ",lo
adfil* scree loadfil, scree  " Print font in memory#      ( ) scree  main work..
. "    ( nbchar  ),     nbline"6 tras scree( )C  BOING   GWXCLASSIC FNTFACE    M
US/GW-FR   DOCGW-FR   DOCGWLINK  BIN"£LIGHT   FNTMORE-CHRDATNO-MUSICMUSRAIN    G
WXSINUS   GWXSTARFIELGWXUP-DOWN GWEYOP     MUS"-GWLOGO BASpooI1,10,F1,01,50,C0,0
9 3D,20,E8,C9h J   $ Ghoul's writer Logo creator $ Tom et Jerry of GPA (c) 1994 
 N  , , "d" B "Ghoul's writer logo creator  Tom et Jerry of GPA (c) 1994"( , (P,
)2 ,P,, F Load .SCR filePZ "Insert screen filename to convert (name    .ext) "-d
 4, (, ) 2,£ " ",fil'n -GW-FR  BASpuuogram" , "Q ..............  Quit"F"" 9  Mul
ti Mark 1.0 user's manuel reader (c) T&J 1994 % Shitty program, no asm code !(2 
N  , , u "Print user's manual (Y / N)""" "Y"  "N"(C) cana "Y"   cana  $F  cana  
 "Printing...."P  "GW-FR.DOC"Z    £ #,!d      # cana, Kn    Nfil""   , , Zx ,P,,
 ,P,, (fil)   d "Loading file..." fil, Put logo into memory J ! "Logo loaded in 
memory."  Save logo !6 "Insert logo filename (no extension please) "- 4, (, ) 2,
£ " ",log, (log)  (log)   dlog  log  ".GWL"H "Press a key to save "(log)  log, ,
, "CPC     GWEp'/7GOWgowpc.gwe", ,p,$ (08HPXhpx!)19AIQYaiqy "*2BJRZbjrz#+3CKScks
$,4DLTdlt %-5EMUemu&.6FNVfnv'/7GOWgowpc.gwe", ,p,$*RB9$A*R,6 Main routine 6J C3,
03,A0,3E,06,21,00,40,11,00,80,06,08,C5,01,4A6T 00,E5,ED,B0,E1,01,00,08,09,C1,10,
F1,01,50,C0,09 3D,20,E8,C9h J    #   ,("&") r "argh"6 "Insert logo filename (no 
extension please) "- 4, (, ) 2,£ " ",log, (log)  (log)   dlog  log  ".GWL"H "Pre
ss a key to save "(log)  log, ,, "    ((( ((( (((((((((((    Cursor speedCursor 
visible Textline 1 colorTextline 2 colorTextline 3 color Textline 4 colorTextlin
e 5 colorTextline 6 colorTextline 7 colorTextline 8 colorColor FxRods colorPaper
 text color*Logo mode*Logo color 0*Logo color 1 *Logo color 2*Logo colFIVE    FN
TFIVE    $$$llllllllX0f8l8vv000000ff008llll888l08ll8llxl88lxll8l0008ll8ll88lll80
00008ll08l8lllllxllxllx8ll8xlllllxdpddp8lldllllllll8lllxllldDllllLlld8lllll8BUBB
LE  GWX!s#r#0J !"29227282q*w#w#w#w#w#w#w0J  2qw 2qw2!ON#F7(*8 28!928!9 2729*8( 2
8!928!9C 2729o&"s5w#w#w#w#w#w#w0J 5xllx8lldhl4xllxlll8l8l8000000llllll8lllll8lll
lDlll8llllll8000L0d000008l0$08lxlllx8ll8lll8l800x000llxxllllll8llxlllll8llll8lll
8xllxll8l8x000000lllllll8lllDl8lDlll808l80llll8l8vff08l8lllllxllxllx8ll8xlllllxd
pddp8lldllllllll8lllxllldDllllLlld8lllll8BULLE   $$$w#w#w#w#w#w#w0J 5  N        
                 * Ghoul's Writer 1.0 *                          Tom et Jerry of
 GPA (c) 1994                       * This program is SHAREWARE !! *          I 
Introducing Ghoul's Writer     Ghoul's Writer  is  a  utility compilation  which
  allows you  to create little  self-executable introductions without ANT PROGRA
MMING. With G.W. , you can send  'computer letters' to your friends,  make artic
les for disk fanzines, etc...  Compared to other writers (Ghost writer de MTI, K
angaroo's letter creator)ab       Select number of blanks between two tabulation
s.         (O)pen      Load a text typed with GWEDIT (only .GWT format).        
 (S)ave      save a .GWT format text.         (C)onvert   convert and save a Com
pressed file (.GWC format). Only this                      kind of file can be u
sed with the linker.                      Warning ! Convert command deletes text
 in memory.         (F)ilename  Give a name to the default  text (new  text or t
ext loaded                      from disk). You mus), G.W  includes many options
 to give a personal touch to your intros (you can use your  own musics, graphics
, etc.. ).    Each intro file built with G.W. is a assembling of data files     
        * a Soundtrakker music          * an OCP art studio format charset      
    * a Text typed with GWEDIT          * a Logo          * a clearscreen method
          * an animation (only for Mode 1 text)    When intro  files are loaded 
 in the Link program,  you can also change other  parameters.            * logo 
mot name a text before saving or conver-                      ting it.         (
D)ir       diskette directory (only .GWT files are printed on screen).         (
A)        select A drive as working drive.         (B)        select B drive as 
working drive.        Editor's commands            (ESC)              go to main
 menu.         (RETURN)           cursor goes to the beginning of next line.    
     (COPY)             Insert a char on a line.         (DEL) & (CLR)      Dele
te a char on a line.  de (1 ou 2)          * colors of logo, of charset, etc..  
        * cursor printing          * text printing speed          * message 'Pre
ss space to continue' in the back of the screen    Let's see what the utilities 
of G.W are !            * an easy to use text editor, which makes Ghoul's Writer
 text files          * a linker which creates the intro file          * a Soundt
rakker's music relocator          * a logo file maker          * a .FNT charset 
file maker with Basic fonts    All these utilities wil       (TAB)              
move cursor from X chars.         (SHIFT) + (LEFT)   Insert a char in the text. 
        (SHIFT) + (RIGHT)  Delete a char in the text.         (SHIFT) + (UP)    
 Erase a line.         (SHIFT) + (DOWN)   Insert a blank line.         (CTRL)  +
 (LEFT)   Previous page.         (CTRL)  + (RIGHT)  Next page.         (CURSOR K
EYS)      move cursor.         (F0) a (F9)        print a special char (129 to 1
39).              2) GWEDIT informations        Gwedit can produce texts of l be
 described in this user's manual. Z80 coders will  find some words  about datafi
les   structures at the end  of the text.  They  could make their own libraries 
of musics, logos, etc...    Run the file -GWDEMO.BIN just to see what we can do 
in two minutes with G.W !      II GWEDIT, the text editor    When I was coding G
houl's Writer,  I faced a problem  Should G.W.  use texts  typed with word proce
ssors or with a special editor   As there are many word  processors on CPC (Prot
ext, Semword, Amsword, etc19 pages in mode 2 or 38 pages in mode 1. Two     text
 structures are used in GWEDIT            * Text format (.GWT extension)        
      This text structure doesn't use any control char. Only the first  byte    
       of the text  has a special meaning   its mode (mode 1, 37 columns  or    
       mode 2, 78 columns).  Each blank is coded with the ASCII char 32.  You   
        may now understand why .GWT text are so long. Why such a simple struc-  
         ture  To use GWEDIT as a scrolltext writer (g...  ), I finally decided 
to  write my own text editor. It is not a great piece of software, but it has th
e  usual basic functions to type a text easily.    1) GWEDIT commands       Main
 menu commands            (N)ew text  Create a new text. If an old one is in mem
ory, it will be                      erased.  When you start  a new text,  you m
ust choose its                      display mode (mode 1 or 2).         (E)dit  
    edit text in memory.         (H)elp      list of editor's commands.         
(T  Nreat for typing  text of           demos !).           * Compressed format 
(.GWC extension)              Based on a .GWT text  format,  this structure cont
ains   some control           chars to shorten it.  Warning ! GWEDIT can't read 
this  kind of text.           So, make a Text format copy of your text before co
nverting  it !        To brighten up a text, it is possible to given out  specia
l chars, with the      keys F0 to F9. Eventualy, you can design your own chars, 
 changing the file      MORE-CHAR.DA In the configuration screen, 'Text speed' f
unction is disabled when the     cursor is selected. When active, this option do
ubles  the speed of char     display. This is really interesting when you write 
messages in mode 2.         When you save an intro, the file created will have t
hese characters                     * loading address         changeable        
          * Entry                   &9000                  * Length             
     changeable       This intro can be loaded in memory and lauT by another one
  in the Editor's  and Linker's  Basic loaders.      File  'MORE-CHAR.DAT' is ju
st a  cut .FNT file,  which contains  ten  chars      (length  80 bytes).       
 You  can also  modify  working charset file of GWEDIT, changing the default    
  file 'SYS-UK.FNT'.  French users could  find their beloved accents with the   
   file SYS-FR.FNT.         III GWLINK, the intro compiler    This program is us
ed to load and verify datafiles to compose an introduction,  define its colors a
nd save a self-nched with a Basic loader, so     it is really easy to use it in 
a disk fanzine.         GWLINK needs 18 to 36 ko to save an   introduction on a 
disk.  To shorten     the length  of an intro,  you can crunch it  with  one of 
these excellent     utilities            * Cheese of Antoine Pitrou (COD!)  fast
 and good cruncher. Unfortu-           nately,  Cheese 1.0 needs some memory spa
ce used by Basic. So, you           you can't start an intro crunched  with this
 utility  under Basic.           Try to find executable intro.    1) GWLINK comm
ands        A) How to choose a datafile pattern           By pressing one of the
 following keys, you select a pattern of datafile.         Thus, commands  (D)ir
 and (O)pen  consider this kind of file  as default         file type.          
           (T)ext file    Compressed text            (F)ont file    ...         
   (L)ogo file    ...            (M)usic file   ...            (1)st Fx file  cl
earscreen method            (2)nd fx file  animation file       B) mainthe 1.1 r
elease which is perfect for G.W !            * Cruncher of Crown (BENG!)   SLOW 
but great program ! Intros crun-           ched with Cruncher can be loaded unde
r Basic without any problem.        You will obtain a new file whose length will
 be between 8 and 12 ko.         If you  really want to save  space on disk,  yo
u  can shorten  an  intro     length.  Just don't use a music,  a logo or an ani
mation in your intro !     To do such a thing, put one of the following files in
 memory.               commands          (D)ir          diskette directory.     
   (O)pen file    load a datafile. Before putting it in memory, some tests      
                  are done to control file structure (loading address,          
              length, Entry)        (S)ave intro   save introduction (all datafi
le must have been put in                        memory).        (C)onfig       c
onfigure introduction. (UP) and (DOWN) arrows to  choo-                        s
e a parameter line, (LEFT) and (RIGHT) arrows to c               NO-MUSIC.MUS   
                        NO-LOGO .GWL                           NO-FX2  .GWX     
 IV GWLOGO, the Logo maker    This program, written in Basic, is really easy to 
use. With a  17ko standard  screen, it allows you to create a logo file (.GWL ex
tension).  You just have  to give the name of the picture and the name  of the l
ogo file !  Of course,  your future logo must be on a  particular place   in the
 left hand top cor-  of the standard screen, and centered on the following heigh
thange                        its value. To come back to the main menu, press (E
SC).        (V)iew intro   display loaded datafile  names and run the introducti
on.                        If  a  parameter file  is  missing, the  intro  will 
not                         start. Note that for an intro with text in mode two,
 you                        you don't have to load an animation datafile.       
 (A)           drive A is active        (B)           drive B is active      2) 
GWLINK tips & tricks        N and width                     - Height    6 chars 
 (  48 video lines)                  - Width     37 chars (  74 bytes)    Don't 
panic  !  I have made another  little program which draws a frame in a  picture 
and saves it as a standard screen file. The area inside the frame is  the size o
f a logo. This magical program is named -GWFRAME.BAS !    If you are not  a grea
t graphist,  you can however make  funny logos.  G.W.  includes a little  clipar
t  library.  Load the  file GW-CLIP.SCR  with your  best            That file is
 made of 145 bytes. Each byte represents one of the             145 lines  of  t
he text screen to delete.  Last byte is  an end             control code. Its va
lue is always 255 (&FF in hexa).                        * .GWE file length   &00
91    .GWX file  animation               A .GWX file is just a little routine do
ing a graphical effect             behind the text (only for a mode 1 message). 
                          * loading address         &9600                       
  * i painting program and make your choice !      V GWFONT, Basic charset to .F
NT file maker    This program concerns only people who design charsets under Bas
ic with the  SYMBOL command.  Owing to GWFONT,  we can convert these  charsets  
in .FNT  datafiles ! Another friendly program  just put your charset in memory a
nd  start -GWFONT.BAS !      UI GW-ST, Soundtrakker's compiled musics relocator 
   GW-ST is one of the more  practical program of G.W.  Thanks to it, you can  c
hange the loading and entry addressenit address            &9600                
         * exec address            &9603                         * end address  
           &9606                         * maximum length          &0A00        
       The routine must not be too slow (maximum, 1 HALT). Only one ink         
    is available, to preserve text chars (ink 2, bits 7,6,5,4).                 
         The textscreen is located between &C206 and &FC9F. There are 144       
      lines of 76 bytes.                          The init adress of a Soundtrak
ker's compiled music.  So, in Ghoul's Writer, you can use musics coming from man
y demos  or music  compilations.    Please note that GW-ST doens't work with ST-
128  music player. I have found  this new () Soundtrakker's music structure in t
he  last musics composed by  the famous Kangaroo of TGS! only.    Warning ! As I
 have coded this program without any documentation about S.T.  music structure, 
some tunes might not work with GW-ST. I have made tests on  some music from demo
s, it's ok. Wais is useful when, for example,  you want to create             a 
co-ordinates table for a starfield in memory.               The end adress is on
ly interesting when you want to display hard             sprites on your cpc plu
s to make an animation. For compatibility             reasons, you must declare 
it in every routine.               Why a .GWE maximum length is &A00  Just to sa
ve space in RAM for             a crunch routine and for Basic datas.           
           VII Author's words about Ghoul's Wrt and see...      VII Informations
 about Ghoul's Writer datafiles    In this part, you will find informations abou
t each kind of parameters files  used by Ghoul's Writer.    .MUS file  music    
             This file had to be created with the BSC's Soundtrakker, or ano-   
           ther music program with a fast music player...                       
             * loading address   &6000                     * init address      &
6000                     * entry             &6003                     * miter  
  I had the idea to code G.W. when I received the  Kangaroo's Letter creator. Fo
r  a long time, I used text files to correspond with cpc users. I liked Kangaroo
's  work,  but I said  to myself  'We can do better.' . So I have decided to mak
e a  more powerful writer, Ghoul's Writer !    Some people may say that the  int
ro coding is not great  (no overscan,  no hard  scroll, etc... ). Well, in fact,
  I wanted to make  a software which  was fully   compatible  with all kind  of 
cpc and crtc,  which we coaximum length    &1D00    .FNT file  TAOCP art Studio 
charset                In this charset structure, a char is coded on 8 bytes (li
ke a mode              2 char,  up to down).  A '.FNT' file contains  datas for 
the ASCII              chars 32 to 127.                                     * .F
NT file length   &0300    .GWL file  logo                File created with -GWLO
GO.BAS. It is just a big sprite !                                      * .GWL fi
le Length  &0DE0    .GWE file  clearscreen method     Nuld run under Basic. It  
limited the way of programming the introduction basic routines.    All datafiles
  (musics, animations, clip-arts) are personal creations.  You are  authorized t
o use them freely.  It would  be nice to tell  where they come from  if you take
 them for your own pieces of software.  Themis  SILVERMA.MUS  and YESOD.MUS  are
 based on two game musics (but are pure  Soundtrakker's tunes !)                
     - Ken's labyrinth 3d (PC) from Ken Silverman !                  - Nodes of 
Yesod INTRO   DATcINTRO   $$$#*"22222a!"+KTTTTTTTTTTTTTTTTTTAWWSKKSWW*8")!"8I%II
,IIII III!IY# 2u y2V(y2&$# !%(!!"2zx0IIyIyIyIyIyz .2(((2fvvvIyIyIv,2ITIyC(CPC) f
rom Odin software.    Ghoul's Writer is a SHAREWARE PROGRAM.  You can copy it fr
eely to your friends,  dispatch it in fanzines or in Public Domain compilation. 
But, you do not modify  programs or datafiles.    If you are a regular user of G
houl's Writer, you have to pay a little bill  and  become a registered user     
                   * 30 french francs (timbres, billet, cheque, pieces)         
            * 6 U.S dollars (banknote only)                     * 10 Deutschmark
s (banknote only !)     IyIy!# TIyIy*&#"&!J0( (w#w#w#w#w#w#w#w#w#w#w2(2!"&0!J0J 
!zIIyIEIxw#HIxwIII(II.IIIIIII*)"8/ !Iy y y y y y y y  TyTTTPPPUUUSSSIIIKKKKKKIII
SSSUUUPPPTTT$ ( * !                * 3 pounds (banknote or coins)    I still don
't make empty dreams about the financal incomes of G.W.  Only seven  cpc users h
ave registered for Multi Mark 1.0. That's not a reson for not doing  it, ok   Re
gistration tariffs are higher than Multi Mark ones. Why  Only be-  cause G.W  ta
kes a very long  time to realize it. Making a lot of datafiles is  really  diffi
cult, you know !    You want to contact me to register, to talk about problems o
r bugs (I hope not)  or just to send your musics A2u#"2u!A"A!ubOJy* #"! (&o)))*O
 2w 2Gw#Gw 2*#"2 ((2*J"*"22!"  #2#"#2a* !X*O w Gw#Gw !"(22a(or clip-arts for a G
houl's Writer data disk   Write to                                Monchatre Herv
e                             College, 1 rue des ormes                          
   45320 Courtenay                             France    One  little anecdote to
 finish.  Do you know where the name  of this writer co-  mes from   It's a  pla
y on words  based on two cpc programs  names  the Ghost  Writer of MTI and an ol
d CPC game published by U.S.Gold, Ghoul's'n'ghosts.    Soundtrakker (c) New age 
Software J *#*"22222a!"2!"!"*(2Press space to continuebOJy* #"! (&o)))*O 2w 2Gw#
Gw 2*#"2 ((2*J"*"22!"  #2#"#2a* !X*O w Gw#Gw !"(22a(  The Advanced OCP Art Studi
o (c) Rainbird                              Tom et Jerry of GPA (c) 1994        
               * Th    College, 1 rue des ormes                             4532
0 Courtenay                             France    One  little anecdote to finish
.  Do you know where the name  of this writer co-  mes from   It's a  play on wo
rds  based on two cpc programs  names  the Ghost  Writer of MTI and an old CPC g
ame published by U.S.Gold, Ghoul's'n'ghosts.    Soundtrakker (c) New age Softwar
e  NLINE    GWEabcdefgpqrstuvwUUUUUUUUUUUUUUUUUUppPQRSTUVW  ABCDEFGxyz()*+,-./HI
JKLMNO89hijklmno01234567XYZ !"#$%&'abcdefgpqrstuvwUUUUUUUUUUUUUUUUUUppLIGNE   BA
SpIyIy!# TIyIy*$#"$!J0( (w#w#w#w#w#w#w#w#w#w#w2&2!"$0!J0J !lIIyIEIxw#yI III(II.I
IIIIII*'"8!u/ !Iy y y y y y y y  TyTTTPPPUUUSSSIIIKKKKKKIIISSSUUUPPPTTT & * !92w
#"T2M!OXM   !# !!*Nw#wYesNo   ((( ((( (((((((((((    Text speedCursor speedCurso
r visibleTextline 1 colorTextline 2 color Textline 3 colorTextline 4 colorTextli
ne 5 colorTextline 6 colorTextline 7 colorTextline 8 coRANDOM  GWEw#dX$"Yr'QT,s2
Sx &yhAji-KUtkG1P.3e c5C!lBWM6gOIz0o7/)pu49Nan8LfH(E*bm+RVJvFD Z%qw#dX$"Yr'RANDO
M  GWEMOUTH   GWE.gwe", ,,a.gwe", ,,GHFIEJDKCLBMANOPQRSTU9V8W7X6Y5Z43210/.a-b,c+
d*e)f(g'h&i%j$k#l"m!n opqrstuvwxyz  .gwe", ,,a.gwe", ,,UUUUUUUUUUUUUUUUUUUUUUUUU
UUUUUUU,!P "frame.scr", ,IyIy!# TIyIy*&#"&!J0( (w#w#w#w#w#w#w#w#w#w#w2(2!"&0!J0J
 !zIIyIEIxw#HIxwIII(II.IIIIIII*)"8/ !Iy y y y y y y y  TyTTTPPPUUUSSSIIIKKKKKKII
ISSSUUUPPPTTT$ ( * !SNOW    GWX  -63H2eB/$)7F*dAQw! 100,65  tabxy2star2 db #!Ps#
r#0J  !Pnb)N#FnbNywy0J J w#wOw ww##  !Pnb)N#FnbNywy0J((  IIw+wOw ww## y-- WC63H2
eB/$)7F*dAQw! 100,65  tabxy2star2 db 81,4, 119,33   G &9600  WRITE "SNOW.BIN"   
 baseecran equ &C250 - 7PC      GWEp   !"#$%&'()*+,-./0123456789ABCDEFGHIJKLMNOP
QRSTUVWXYZabcdefghijklmnopqrstuvwxyz  Nn fichiers, mais prennent pas mal de plac
e (108ko et 240ko, je crois), le dernier est encore plombe.  Pour alimenter  ta 
BBS,  tu trouveras aussi deux utilitaires, Cheese 1.1 et Digitraker 1.4. Je n'ai
 pas pu te met tre plus  de disquettes,  car je suis en rupture  de stock, mais 
si tu veux d'autres  programmes (demos, utils ou jeux) pour ton serveur,  je peu
x t'en procurer !  Cette presentation a ete  realisee a- vec une preversion de m
on nouvel uti- litaire, Ghoul's Writer. Si tu es in- teresse,  je t'en UPDOWN2 B
INOANBMCLDKEJFIGHpp  zyxwvutsrqp o!n"m#l$k%j&i'h(g)f*e+d,c-b.a/012345Z6Y7X8W9VUT
SRQPOANBMCLDKEJFIGHppUP-DOWN2BASpSUBMARINGWX!Ns#r#0J !"K2I2J2G2H22MM(2M*K w#w#w#
w#w#w#w0J J 2 22JN&o)N#FG 62GH 2H!C I C2I2M2I2GH2H!C Io&"K sEw#w#w#w#w#w#w0J EFi
le saved succesfully.No text to save...Error... File has no name.!N  +xi!#F#'  .
22!A2Gk!XNa(i(q(0y(A(I(Q(0Y(#-GW-ST  BASpll"(s( lon,),,)) ,("&"(s( lon,),,)) 4 S
oundtrakker compiled musics relocator v 1.0 $ Tom et Jerry of GPA (c) 1994 Revis
ion du 23/08/94 !  N  , , R "Ghoul's Writer Soundtrakker relocator v1.0  Tom et 
Jerry of GPA (c) 1994 " (P,"")( ,P,,2  Variables de travailFP bas  Z ad   add gw
star  n gwlon  x""mar"" datad fintabl  load St fileH£ "Name of the S.T file to l
oad (Enter  Directory)  ",loadnam+ loadnam""   , , "d"   ,P,, ,P,, loadnam, bas 
,& Test file (is it an ST file )Qmar""   bas     basdmarmar(( )) mar"ST-Module" 
  "File is a Soundtrakker Interrupt mod  Nule. Changing it into in a Raw module.
.. "  Qmar""   bas  8   basmarmar(( )) mar"ST-Module"   "File may not be a Sound
trakker compiled music..."    "Do we continue (Y/N)""" "Y"  "N"(C) "N"  ", Conve
rt St file60 oldstar  ()  (())  J£ "New start adress (Hexa)                &",st
arJT star("&"star)  star     j ad( datad)( datad) ad ad deca  datad,("&"(s( ad,)
,,))  datad,("&"(s( ad,),,)) datad datad    datad   fintabl       Change pattern
s adresses6  lon   gwlon   "File is too long..."8 B       ,("&")    (savenam)M (
savenam, ,)  "."  savenamu(savenam, ) .$#.savenastar   star  $ deca star   oldst
arhr "Please wait..."     Save New st-file£ "Name of the Soundtrakker file to sa
ve  ",savenam"  star gwstar   9 "Save as Ghoul's writer music file (Yes / No) "0
"" "Y"  "N"(C) "N"     bas gwstar, "Press a key to save file..." 4 savenam, , ba
s, lon, starmsavenam".MUS"8 *B 21,00,40,11,00,60,01,00,1D,ED,B0,C9L#V Search fir
st pattern adressj patter   datadOt fintabl bas   oldstar  ( patter)  ( patter )
 patter patter  #  patter   fintabl  K transi   bas oldstar  ( patter)( patter)T
  transi   fintabl  ( patter )     fintabl   transi   Change Interrupt music mod
ule int Modify adresses  (& wor wor  ("&"wor)0  wor   b) ad( wor)( wor)D  ad old
star   ad  oldstar lon   XiN ad ad deca  wor,("&"(s( ad,),,))  wor,("&"(s( ad,),
,)) X &blv adresses to modifyG 4001,4004,4007,400F,4013,404E,4052,4056,405B,4060
,4063,4066,4069G 406F,4075,407C,4083,408A,4091,4094,4099,409C,409F,40A3,40A6,40A
9Bo raw music module8        ,("&") lon   lon  $R ,("&"(s( lon,),,)) ,("&"(s( lo
n,),,)) * 21,24,40,11,00,40,01,00,00,ED,B0,C9UTP  #  patter   fintabl  K transi 
  bas oldstar  ( patter)( patter)T  transi   fintabl  ( patter )     fintabl   t
ransi   Change Interrupt music module int 40AD,40B0,40B3,40BD,40C2,40CC,40D1,40D
B,40E0,40EA,40EF,40F8 4107,4121,414A,414E,4154,4178,41B1,41CF,41D4,41D9,41DEG 42
2D,4250,4257,4275,428F,4295,4298,429D,42A8,42BA,42BF,42C2,42CA 42DA,42DF,42E2 43
06,4308,430A$ 4442,4444,4446,444A,444C,444E$ 4452,4454,4456,445A,445C,445E$ 4462
,4464,4466,446A,446C,446E$ 4472,4474,4476,447A,447C,447E$ 4482,4484,4486,448A,44
8C,448E$ 4492,4494,4496,449A,449C,449E$ 44A2,44A4,44A6,44AA,44AC,44AE$ 44B2,44B4
,44B6,4-GWFONT BASp.. " + savefil, , font, ad,& Ghoul's writer .fnt file maker$ 
Tom et Jerry of GPA (c) 1994K Remember, only works with font loaded in RAM with 
Symbol commands !   , , E "Ghoul's writer .fnt file maker  Tom et Jerry of GPA (
c) 1994" (P,"") ,P,,(2 Variables de baseJF nbchar nbline scree font4BA,44BC,44BE
)  44C2,44C4,44C6,44C8,44CA,44CC,44CE3* 44D0,44D2,44D4,44D6,44D8,44DA,44DC,44DE,
44E04 0H HeaderR8 f       ,("&")9f 21,A0,BE,11,00,C0,06,08,CD,77,BC,79,32,B0,BE,
78,32p B1,BE,CD,92,BC,C9z    (loadnam)    ,((loadnam, ,)) ,(loadnam)(  lon()() M
odify tables datad   bas   oldstar  (C)(C)    N ad font Print font in memory#   
   ( ) scree  main work... "    ( nbchar  ),     nbline"6 tras scree( )C  ad,( t
ras )  tras , ad adJT Save font file !hMr£ "Name of the font file to save (no ex
tension please)  ",savefil*savefil(savefil,,)".FNT"- "Press a key to save file.C
HAMPAG2GWXB/$(6Fdz,NE&5&4I h1#!s#r#0J !nb)N#Fnbw w)w0T!-Ny Hq###  !nb)N#Fnbw w*w
0T!-Ny Hq### x-, VC83H2d B/$(6Fdz,NE&5&4I h1 104,49,2    tabpoint db 8,8,4,4,2,2
,1,1,2,2,4,4,8,8   &9600 .. " + savefil, , font, ad, , font, ad s( ad))) main wo
rk... "    ( nbchar  ),     nbline"6 tras scree( )C  ad,( tras )  tras , ad adJT
 Save font file !hMr£ "Name of the font file to save (no extension please)  ",sa
vefil*savefil(savefil,,)".FNT"- "Press a key to save file.xt  Font  Logo  Music 
 1st sfx   2nd sfxCommand    (D)ir   (A)    (B)    (O)pen   (S)ave all  (C)onfig
  (V)iewFile             .   12IDROS8 ABTLFMC  V C!!9!X Ghoul's Writer Linker  v
1.0 Coded by Tom et Jerry of GPAThis program is shareware !! 0#w+y0w!+!!  Z2'2Z!
 scree  main work... "    ( nbchar  ),     nbline"6 tras scree( )C  ad,( tras ) 
 tras , ad adJT Save font file !hMr£ "Name of the font file to save (no extensio
n please)  ",savefil*savefil(savefil,,)".FNT"- "Press a key to save file... " + 
savefil, , font, ad s( ad)))CURTAIN GWE  ad,  "pc-cga.gwe", ,,zyxwvutsrqponmlkji
hgfedcbaZYXWVUTSRQPONMLKJIHGFEDCBA9876543210/.-,+*)('&%$#"!   ad,  "pc-cga.gwe",
 ,,UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUACCENTS DATPP,0Hxv$f$$fff$Bfffl8lfff0Hxv$f$$f
ff$Bfffl8lffffff$GWDEMO  BINFFIVE    FNTLINEOUT FNTOGW-CLIP SCR£ACCENTS DATGW-CL
IP SCR,!P "frame.scr", ,   N         G-W     GWL  00p00p33w313wf3 3 DDDD  D D   
 ppP0Pppp Pp PPPPPp PP0PPpp pP0pPp   0  $XPPPPB$XPP PpPp(PBP(PpAPPP(A0P0PP$P$XPP
PPB$XPP  PP(PPB4x4x04744x004t4ppp Pp PPPPPp PP0PPpp pP0pPpxx4xxx04444xx00p4px0p4
x0044%!ZZZZ-ZZJ%ZKZH-!0ZhaZZZHRZZHZJZZ!RZJZZZZ0ZxZJ!RZHZ4%ZZ-ZZJ%ZKZH-!0Zha0ZhCL
GH!.#,CH!H!,CHGWDEMO  BIN/"/" #F# ##TO0#N#F#bkw YCrownCruncher1.0SWelcome CPC us
er !  You entering the last GPA production,   Ghoul's Writer   A fantastic utili
ty  which allows youto create  self-executable  introduc-tions without  any prog
ramming !  Youjust have to select and load some pa-rameter   files, define  opti
ons, andyour intYY is bornYC makenice paintings,  compose  great tuneson cpc,  h
ow lucky you a,CH!,C!H!,CH,CH!,C!H!,CH,,c1lc/!1lCHll1l1lcl1H!c11s11ss111s0q11s  
NreMZcaninclude  them ingYG,  togive  a more  personal touch  to yourintros !  I
s it the best cpc wrY3Well, just try it !  G.W. is SHAREWARE   WarnYWarnYA  Z is
 a16  pro-gram. It means that if you use it re-gularly, youY#nd your user'scontr
ibution    10 Deutschmark  30 french Francs  6 U.S Dollars or 3 Pounds  $ To reg
istergH to  $  Monchatre Herve College, 1 rue des ormes 45320 Courtenay  e  Gree
tings    I6ould like to greet,/ffCgggggggh0hRhRhhhiiijgjklklkkg1k0lllmllllm8gmm3
n3nnn tg1n7ooooo/p2pngFHIKIHDFHIFgMPRMPMKMPRgg MNPRPNMNMKNMMIMPRTUWYYWUWTUTPMMKI
HIKMUhKIHIKhIFHFIMKIFRRRRRMPUTPPPPPPPFhFRhhADIHDDPPPFHIKMIPMKMMIKKedusers of Mul
ti Mark 1.0,  another GPAsharewareY'! They are only 7 !  Antoine Pitrou ('of MMP
F)  Gerey Yves (Madram of Beng!7Druelle Bernard (BeberXCayrier Serge (Siriust)ho
tard David  Mitermite Michel (MandelaBruno Didier (Chronos)  So, let's try to be
at this record ()withZ)REGISTER !    What is GPA     GPA is a*group of coders. T
heyhave made demos (Monst4the darkness, G.Y 90, GPA demo 3,  Music Pack1 to 4),5
cracked   games  in thepast (nasty boys).   M-si-£i0j#1j9FFFFFFFDDDDDDDAAAAAjBBB
BBkOjkFkF&k/kDkDkAPkYkkBkkk#KKKKKKKIIIIIalHHHHHHHT.lHjkllost of GPA guysare now 
on PC,  but me, Tom et Jerry,still supports CPC computer.  My lastY!s are Demine
ur, a little game,and  -Mark, the firQYshare-.  Newoftware projects !  AUdemo an
d a new release.Coming soon onBscreens...  wf!c!c6rr6nfw#N#F#ut qp##2z22822c2c2c
2cJb JbbbD b!5!ccIa!cdIa!d dIa 28!c(wOb!b!cwO b#Fp#uKllIllHllWk "."."m,8,8n8)5)5
n5*6*6!n6m."6n,8,8Fn 8)5)5Zn 5*6*6nn6hFnnnDDnnnXn2n'3'3Jo3ZnFn6oFn".Mo3 3wRP 31w
Q-f3 3 PDRDTPPVDPD b DPtQDRUQP PQRUQPta#w&wwOb6 nf  ##V##V5+wa5anf((( w!cw#w  #(
wSw#(wr !BdPYa$(bbbb wwa66  ww45(gnFBO!caKfnN#FnfMbLbfn  0ObnfFOx(Gy2x2b2#O!d#Vs
r6a#2a#w a66£2#2ayxyyIOyI8g8gngP QRUQQQRQRUQQ 0Q QRU $XPPPPB$P"XPP PpPp(PBPP(PpA
PPPPR(A0P0PP$PRPPR2 PP(RPPB4Px4PR x047 PPP 0 tjxx4Qxxx0 41QxX 0p4pM / hawGGp1S$Z
8fR-wqjdYTPKGC852/-*(&$" ZgPgd"eBedfTk7PgbeeBePf n PtdfWST-Module.c def"fbeBfbfd
ddd*dffffdd dVdVdVeV     gl a f fff  Nx0pQ0 i%!Z-ZZJ%QZKZH-! 0Zha ZZZHRZZHZJZZ!R
ZJR4ZZZZ0ZxZJ!RZHZ4%ZgTR%CLGH!.#,CSH!H!,CHRp!,Cg!,C£,c1lc/!1lCHll1l1lcl1H!c8#"!A
"A!u&b(YOJy* #"! (&o)))*O 2w Gw# 2*#"2 ((2*J"*"22!"  #2#"#2a'!XJbz!"(22a( J *#*2
222a B2!"!"*(2Press space to continueQ!Ps#r# 7!11s£11ss1£P0qP%P00Qp0  ppP0Pppp P
p PPPPPp PP0PPpp pP0pPpw88lllR"lllll0f8l8vv8R00000ffPT0PV8p8x8nPP1 !Pnb)N#FnbNyw
y 9((  IIw+ ww##  !1EaywOwy-- i63H2e nH"07'-Z5vF*9f85E/+b3XPPPPPPPP........xxxxx
xxxVVVVVVVV4444444408p8PDp88p88v88*xflxlf#v8$fl88l0fpP$Xp8TPvPvpppP&x888x8PlPPPv
PppppvPP8PlPl8lP8r0vSffVl8xp8DD8z#V#NP0O0MOp0O#c # #F##V# #QO0 #F# #S #F# ##TO0#
N#F#bkw........xxxxxxxxVVVVVVVV444444440pp0 8lBfQT,s2Sx &yhAji-KUtkG1P.3e c5C!lB
WM6gOIz0o7/)pu49Nan8LfH(E*bm+RVJvFD Z%qw#dX$"Yr'+TTUWSXLHMVFWNTKKIKIKJJJA*8")!"8
I%II,IIII III!IY# 2u y2V(y2&$# !%(!!"2zx0IIyIyI"yz .2(( 2fvvLARGER  FNTLARGER  $
$$888888llllllll0f8l8vv800000ff08p8x8888n08p8p88p88v888888xflxlfvGyIv,2ITIyCI!# 
T *&#"&!J0( (w#w#w#N2(2!"&0!J0J !zIIyIEIxw#HZ II(E.OYc1I*)"8/ !IyP yPyPyPyPyPyP!
y  TyTTTPPPUUUSSSIIIK4IIISSSUUUPPPTTT$ ( * !A2u   N         v8888fl88l0fppppp$p8
vvvpppx888x88888lvppppv8ll8l8r0vffv888888xflxlfPC-CGA  GWEbqsuwyad,  "pc-cga.gwe
", ,,  "$&(*,.02468BDFHJLNPRTVXZbdfhjlnprtvxz !#%')+-/13579ACEGIKMOQSUWYacegikmo
qsuwyad,  "pc-cga.gwe", ,,UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUULINEOUT FNT*LINEOUT $$
$llllllllX0f8l8vv000000ff08p8fff0p8p800Fffxv88888l8l00000F$0Ffn6FffFfF60 00bflvF
fffff,xlflFfffFffFfN00 06fFfffFflh8lfdf0F0f&ffFvff0FffxSCRIPT2 FNTSCRIPT2 $$$(((
$$$HH(bd&F8D8Vv0   00ff0 %IQB 1B!B"D  aA"!AA!A0    BBB"AA.!A !!B X  X GAA."DD  A
B."AA  A%!AA%#AA!AABNO      GWX  $$$    $$$  D        GWDEMO  BINFINTRO   DAT LI
NEOUT FNTOGW-CLIP SCR£ACCENTS DATGW-CLIP SCR!!!AEB9!DBA B  ""D8""AAII*6"c(D    !
 08$ B!AB!BDt!x   !!  ""DD0DD8$8$B  6ZR""DD!AB!!BB#   """DD8""$!)JZlB$8H!!"8 !0"
"DD80!6H# FB"AA.!A !!B X  X GAA."DD  AB."AA  A%!AA%#AA!AABIyIy!# TIyIy*&#"&!J0( 
(w#w#w#w#w#w#w#w#w#w#w2(2!"&0!J0J !zIIyIEIxw#HIxwIII(II.IIIIIII*)"8/ !Iy y y y y
 y y y  TyTTTPPPUUUSSSIIIKKKKKKIIISSSUUUPPPTTT$ ( * !2u  PSQUARE  FNTSQUARE  $$$
llllllllX0f8l8vv000000ff008fffflfffffffffffff00000ffw  #(wSw#(wr !BdPY(bbbb ww#u
t66  ww45(gnFBO!cw#wfnN#FnfMbLbfn  0ObnfFOx(Gy2x2bG2#O!d#Vsr6a#2a#w a662#2ayxyyI
OyIfffM / hawGGp1S$Z8fR-Zl88lfff0f00000f$0ffffff600800fffffffflxlfffffffffff0000
0fffffffl8lfff0f0fffffvffwqjdYTPKGC852/-*(&$"  ST-Module.d"eBebeeedeBefBfBebff S
YS-FR  FNTSYS-FR  $$$ savefil, , font, ad.llllllllX0f8l8vv000000ff008fffflbfffff
fffffff00000ffxvfffffffffflffflbhxhbbhxhffffffffxflxlfbf8ll8                    
  g g g g g gbgggggggf3hQhehzhzhhhhhhhhhf iyi*jyiyiyijhkhklhklhkf181118114844696
6IIIIff8lvfflfffZfffffffffffl88lfff2f00000f$0xvfffffvf60x00xfflvff8ffflxl8lfffff
ffffvv00006fffffffll8lfffL2f0fffffv3333xvfffffffffflffflbhxhbbhxhffffffffxflxlfb
f8ll8IGGGGGLLLLLNNNNN1811181148446966PNLNPNLNPNLNPIKGKLNLKIKGKLNSPNLNKKNPSPQPNLN
IPQPGNPNLKGIPQPGNPNLKGIDIDGBDGLGLGNPNLIPSPSNLNPSSUSPNNPLLIIIIIGGGGGLLLLLNNNNNWAL
ES   MUSwf!c!c6rr6nfw#N#F#ut qp##2z22822c2c2c2cJb Jbbbb b!5!ccIa!cdIa!d dIa 2!c(
wOb!c(wOb!c(wOb!cwO b#Fp#uta#w#utwwOb6 nf  ##V##V#ut wa5anf((( w!cw#  N££££IIIII
GGGGGLLLLLNNNNN-GWFRAMEBASp, P,., P,,!P "frame.scr", ,,0 GW cadre * Utilitaire G
houl's Writer 1.0$ Tom et Jerry of GPA (c) 1994  N  , , A "Ghoul's Writer Frame 
Maker  Tom et Jerry of GPA (c) 1994" (P,"")V( "Screen in mode (0) or in mode (1)
 """ "0"  "1"C32 "Press a key to save file FRAME.SCR"  ()  &F ,.££££GGGGGLLLLLNN
NNN, P,., P,,!P "frame.scr", ,,o save file FRAME.SCR" $A*R0 GW cadre * Utilitair
e Ghoul's Writer 1.0$ Tom et Jerry of GPA (c) 1994  N  , , A "Ghoul's Writer Fra
me Maker  Tom et Jerry of GPA (c) 1994" (P,"")V( "Screen in mode (0) or in mode 
(1) """ "0"  "1"C32 "Press a key to save file FRAME.SCR"  ()  &F ,.ARMY    FNT£A
RMY    $$$llllllllX0f8l8vv000000ff000,f,fn,ff,lnblf,,flff,,ff,ff,,ff.f,00000,ffh
lf8lfffnfffX-GW-UK  BASpuu ogram" , "Q ..............  Quit"F"" 9  Multi Mark 1.
0 user's manuel reader (c) T&J 1994 % Shitty program, no asm code !(2 N  , , u "
Print user's manual (Y / N)""" "Y"  "N"(C) cana "Y"   cana  $F  cana   "Printing
...."P  "GW-UK.DOC"Z    £ #,!d      # cana, Kn  VBlL000000,f.$0hlflfffl,ff,ll,fn
,60x000.ff.llffff8ff,flhlLlffff,fff,lfflllv.,l0006ffff6ffLl(lfff.l2,fn,0ffff6,fn
,vffhlf8lfffnfffXcana            ,(,,   ix   , "R ..............  Restart progra
m" , "Q ..............  Quit"F"" "r"  "q"(C) "q"    ware !     , u "Print user's
 manual (Y / N)""" "Y"  "N"(C) cana "Y"   cana  $F  cana   "Printing...."P  "GW-
UK.DOC"Z    £ #,!d      # cana, Kn    NCHAMPAGNGWXeCHAMPAGN$$$ww0w## x-, VC#!s#r
#0J !nb)N#Fnbw ww0w##  !nb)N#Fnbw ww0w## x-, VC83H2dB/$(6Fdz,NE&5&4Ih1       ggh
hgghhUhuhuhhhhh%iGiiuiigjj&k&kjj&kkkkkkFllkllllbmAg#!2%#2"#2#!!!!2!2$222J7JW!((#
!j!!R( 6 ##m6nxnxnm6nxnnooooUppopppp+qgFDAAAAADAFDAAAAADAIHFDAABAABABABABADFIFIM
IMPPRFIMMPMPRFMKFMFNPNMIKMIMDKDIDIKDIDHDIKFMKFMFNPNMIKMIMDKDIDIKDIDHDIKRTUTUTUWU
TUTTRTRRTUWYYWWYMA5)FDADEPECHE MUSmm,1,3,1)0)1)0)0*.*0*.*".".".".wf!c!c6rr6nfw#N
#F#ut qp##2z22822c2c2c2cJb Jbbbb b!5!ccIa!cdIa!d dIa 2!c(wOb!c(wOb!c(wOb!cwO b#F
p#uta#w#utwwOb6 nf  ##V##V#ut wa5anf((( w!cw#ADAAADAADADFDAADAAADAADADw  #(wSw#(
wr !BdPY(bbbb ww#ut66  ww45(gnFBO!cw#wfnN#FnfMbLbfn  0ObnfFOx(Gy2x2bG2#O!d#Vsr6a
#2a#w a662#2ayxyyIOyIgAggM / hawGGp1S$Z8fR-FMKFMFNPNMIKMIMDKDIDIKDIDHDIFMKFMFNPN
MIKMIMDKDIDIKDIDHDIwqjdYTPKGC852/-*(&$"  ST-Module.d"eBebeeBeef"fdBfbfdfBefff   
                 N".".".".*6*6*6*6'3'3'3'3%1%1$0$0".".".".*6*6*6*6'3'3'3'3,8,8,8
,8*6*6*6*6%1%1%1%1,8,8,8,8-9-9-9-9'3'3'3'3*6%1%1%1%1,W8UR'3'3'3'3*6%1%1%1%1,W8U 
8p3 "p""ff"DbwRH3*3 0w#E 333D*p*8'3'3'3'3*6%1%1%1%1,W8U8'3'3'3'3*6*YYY%1%1%1%1,W
8UR,8FMKFMFNPNMIKMIMDKDIDIKDIDHDIKFMKFMFNPNMYYYMDKDIDIKWDURIK.*0*1*0*1,0,1,3,1)0
)1)0)0*.*0*.*".".".".*6*6*6*6'3'3'3'3,8,8,8,8J"ww  w0d13wwgw1- -nR     "D  sPPp 
n-wrxZZZZZZJ"Dw    1wGw3DD  UfU"3w34"0ppwRxwpfpp'3w8p3p3wGW-CLIP SCRGW-CLIP $$$1
"wpwHPpw wppww)D3p3f3007wppwJ0"w  p3wJDpp"UD! 3fp0pppDT*((pD"8pf3.3.3GY 0pppwL33
4"3T0U!30T D(( GQpDT  N8p3 ""0pDU33DDw!"wCw3" w  **ppw*p "D3wfnsf P-n p b-  ZZ" 
   rDwnDvyD    g  "wwp  33""1D0dP1UB"w   1gwdwUD3wGwVw3UUwE0UUUU"Uw3p33)0pppwRxf
pwfpp33Zxw0wfw7wtqT"fUUUU3"03 "p3%Dpwpp'343p3ZXw3w00wx"T pw"UDAp(( fpppD((wwp0" 
D3w0"30pfww3UUDA w3p0pD((2wf3pQp 3.fG.fG30DDZHf UfE  D377Dw0  w3E *w0" D783 p33"
"ap wwED77 w"3p w" *f00wwE*DD  P  "33pfwEoUgK" yf03Uw   UDU"D3ww30pw3pXp3w33w Z8
ppp773  D"D"wwD3Upw 03PJfpw 03p37x33pwxpD0!PZPZp03"Ap(( w3p0D *((8"p00QUD0w0w-p3
3wpw3"830 " 3DAp(( p0pD D((8"3p0QwT3gvGvGpT33w"03 w" U"30**wpA"w3w"UUwffH ED3L'L
333f"0 w33E *wpw"Dww     U UwDUUp pUUx"UDgQw-tpqUV3Uw3w *WUfQwKdVT"w p    "f*30"
KHfD  PPPnwwZZZZH3"   *wwwD   p"  N "3pwZf,f3 p300pp3wp0pwpUpp773Zx3wp Dwp" w!ZZ
ZZZZZZZZ3wpp"Ap(( G3DTfg((g 8" 00D 8pDP300fp ! %$w3"App(( "Pp D"(( 8"0QUp"vv3DED
fwEC3" g 3EDx   *8  Ew"DDh" !3ED3Dp   *wpZ""3w   0 1wtqU%" 11%UdC,%sVW"UEUU UUUU
UUUUUD   "3  GsbZZZKJZDw  s£U.""ffs"  0.P "w -GW-UK  BASKGW-FR   DOCGW-UK   DOCz
-GWDEMO BASGWDEMO  BINFINTRO   DAT LINEOUT FNTOGW-CLIP $$$£ACCENTS DATD3D-Aw"wpw
"ww0w803ww 033DJ08p0F3  N1        .GWT !"%()*.!2228X x2I!i!!!!K!e!u!#V#uZ#!Ofl!O
f!Ofl!N6 2 22!XY6 !6 I2!/"0y220!X"fy2h!f!OfDIa*.GWTGhoul's Writer editorGWEDIT  
BINGWEDIT  $$$or...Error...  File has no name...e...M   !"(2%22J!O  22T #8Ik2$O(
y 8qy##S*(%J( GO!P( O(!yO 3y! ( wwwwwwwwQy!X ( w#ww  GPA (c) 1994(O)pen  (S)ave 
 (N)ew text  (E)dit  (T)ab  (C)onvert(H)elp  (D)ir   (F)ilename  (I)nfo  (A)   (
B)File                 Page   C01Line   C01Column C01IHD3TOWENSFCA4B!(!E!d#V# K!
CdGhoul's Writer editor v1.0 Coded by Tom et Jerry of GPAThis program is sharewa
re #ww#ww#ww#ww#ww#ww#w!(2( 22 SOO 2ASOSO# AS #####O2y2y0OxG!6 # !6 SO2y2y0OxGTO
S*!"TG$"2( 2S## 2S(  22S! (!!Editor keys are Cursor keys   - Move cursor on page
 Copy          - Insert character (on a line)Del & Clr     - Delete character (o
n a line)Shift + left  - Delete character (whole text) Shift + right - Insert ch
aracter (whole text)Tab           - Move cursor of x charactersShift + up    - D
elete lineShift + down  - Insert lineCtrl + left   - Previous pageCtrl + right  
- Next pageReturn        - Go to next lineEsc           - Return to menuFor more
 informations, rea2OOGSx2SO 6 #SG s#TSS 2 *MD*0%og" S !2 *MD*BT#SB! y0OxGd the f
ile GW-UK.DOC!!R( (((2!T!R 0#w+y0w !r!p!!!!Change Tab value with left and right,
 (Esc) to end 610!!E Z2!2Z!w03!0+z0&!2Z!)!XI2!2Z!6 !Type filename to load, (Retu
rn) to validate, (Esc) to abort  Loading error...File loaded succesfully.!6 2D!!
 (6!"(#  N0a8 8D(O2DsD(O6 2D !Error, no text in memory...(!O!1(2(%( (22Warning, 
you will erase current text, (Esc) to abort.Textmode (1) or (2)   another key to
 abort!W!E!XI  ! !Z2!2Z2!0$!0!2Z!!2Z!Please type filename,  (Return) to vali  GP
A (c) 1994(O)pen  (S)ave  (N)ew text  (E)dit  (T)ab  (C)onvert(H)elp  (D)ir   (F
)ilename  (I)nfo  (A)   (B)File                 Page   C01Line   C01Column C01IH
D3TOWENSFCA4B!(!E!d#V# K!CdGhoul's Writer editor v1.0 Coded by Tom et Jerry of G
PAThis program is shareware date, (Esc) to abort  Saving error...File saved succ
esfully.No text to save...Error... File has no name.!N  +xi!#F#'  .2I2I!KA2Vk!XN
a(i(q(0y(A(I(Q(0Y(#LEGEND  MUS/#/#/".".".".Iwf!c!c6rr6nfw#N#F#ut qp##2z22822c2c2
c2cJb Jbbbb b!5!ccIa!cdIa!d dIa 2!c(wOb!c(wOb!c(wOb!cwO b#Fp#uta#w#utwwOb6 nf  #
#V##V#ut wa5anf((( w!cw#   !!""(J%2*"jH£O!£*TG  w  #(wSw#(wr !BdPY(bbbb ww#ut66 
 ww45(gnFBO!cw#wfnN#FnfMbLbfn  0ObnfFOx(Gy2x2bG2#O!d#Vsr6a#2a#w a662#2ayxyyIOyI"
gdggM / hawGGp1S$Z8fR-#y(  6#q#(#   ( kb"!w*   !*+ (##6 "! !kZ22Z!k0!*##0 02Z!2Z
        .GWCWarning ! Convert will erase text in memory... (Esc) to abortPress a
 key to save converted text (Esc) to cancelNo text to convert...Saving error...E
rror...  File has no name...wqjdYTPKGC852/-*(&$"  ST-Module.d"eBebeeee"fBedBfbfd
fBefffg         !kZ22Z!k0!*##0 02Z!2Z        .GWCWarning ! Convert will erase te
xt in memory... (Esc) to abortPress a key to save converted text (Esc) to cancel
No text to convert...Saving error...Error...  File has no name...  N     gg,hnhh
hhKiiKijdjjjkk)kAk)kAkk"gkkrkkkkkk l/#/#/".".".".I/#/#/".".".".IST3-/8,D6&4*3,/8
12124*6&8"8"6&8"6&4*3-/8,D6&4*3,/ 8IIKLKGDIG%1%1%1%1(4(4(4(4#/#/#/#/*6*6*6*6%1%1
%1%1(4(4(4(4#/#/#/#/*6*6*6*6%1%1%1%1(4(4(4(4#/#/#/#/".".".".%1%1%1%1(4(4(4(4#/#L
lllllllllllmdgYmYmjmmmmmmmm!njnononnnoYooYoog%148%148(48(48*6*6*6*6%148%148(48(4
8*6*6*6*6-9-9//8,88,88-99-99-9-9//8,88,886-984-98IIIIIIGGGGGGDDDDDDDBBBBBBIIIIII
LLLLLLDDD 6#q#(# ( kb"!m*   !*+ (##6 "! !aZ22Z!a0!*##0 02Z!2Z!"        .GWCWarni
ng ! Convert will erase text in memory... (ESC to abort)Press a key to save conv
erted text (ESC to cancel)No text to convert...Saving error...Error...  File has
 no name...DDDDBBBBBBIIIIIILLLLLLDDDDDDDBBBBBBIIIIIILLLLLLDDDDDDDBIDIKLKGDIGIKLK
GDIKLNPNKGLKPLPNKSNNIRSUUSPSNNNLKGIIGLKGGILIPNKLMIRAGE  GWE  ywusqzxvtrpnljhfdbo
mkigecaYWUSQZXVTRPNLJHFDBOMKIGECA9753186420.,*(&$" /-+)'%#!  NQPLILNQPLGIQPLUSQP
LIGLKGGIIIIIKLPNKLLLLLKNNNNNLPPNPNLNPPNPNLNNNLNLKLNNLNLKLIGLKGGIKLIPNKLLLLLNIIDI
IIIILLLLLDDDDDDBBBBB%e(U,C*K%e(U,C*K-*xt  Font  Logo  Music  1st sfx   2nd sfxCo
mmand    (D)ir   (A)    (B)    (O)pen   (S)ave all  (C)onfig  (V)iewFile        
     .   12IDROS8 ABTLFMC  V C!!9!X Ghoul's Writer Linker  v1.0 Coded by Tom et 
Jerry of GPAThis program is shareware !! 0#w+y0w!+!!  Z2'2Z!L(T--*L(T-%e(U,C*K%e
(U,C*K124*/86&/8124*6&8"8"6&8"6&4*3-/8,D6&4*3,/812124*6&8"8"6&8"6&4*3-/8,D6&4*3,
/ 8IIKLKGDIG%1%1%1%1(4(4(4(4#/#/#/#/*6*6*6*6%1%1%1%1(4(4(4(4#/#/#/#/*6*6*6*6%1%1
%1%1(4(4(4(4#/#/#/#/".".".".%1%1%1%1(4(4(4(4#/#  NNO      GWL  PIG     GWL  pp  
Pp0w3333pw3ww33 033f3w3wwwwp33wf33w30pppppp0pppwpwpq0ppp0ppwpp0pf00pp00p ppp0fpp
ppqppp000pppwwfw3fwww3wwww33wwwwwpp3f3333www3333f3w30pp3ppppp00p p p0333w00ww3wp
pp3333www33333w3f33ppppppppppppwppppppppppppwpppppppppppppppppppp0ppppSILVERMAMU
Swf!c!c6rr6nfw#N#F#ut qp##2z22822c2c2c2cJb Jbbbb b!5!ccIa!cdIa!d dIa 2!c(wOb!c(w
Ob!c(wOb!cwO b#Fp#uta#w#utwwOb6 nf  ##V##V#ut wa5anf((( w!cw#0wwwww3wwwwwwwwwwww
fww33333w3ww3333w3wf33wp33 0w33333wpwwwwwwwww3wp0pppppp3wwww3w3wwpw3w33ppppppppp
w0ppppppppw  #(wSw#(wr !BdPY(bbbb ww#ut66  ww45(gnFBO!cw#wfnN#FnfMbLbfn  0ObnfFO
x(Gy2x2bG2#O!d#Vsr6a#2a#w a662#2ayxyyIOyIbfffM / hawGGp1S$Z8fR-pwppppppp0wfppppp
pppppp0ppp0pppp0pppppwwww3wwwwwwwww3wwwww3wwwwwwwwwpp33w3333w3ww3www3ww33pUpp30 
 p  NwqjdYTPKGC852/-*(&$"  ST-Module.d"eBebeee